CTSG protein (Cathepsin G)

UniProt : P08311, Q6IBJ6, UniProt ID: CATG_HUMAN, Q6IBJ6_HUMAN,

CTSG protein (Cathepsin G)

Homo sapiens

MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVL
TAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRR
NRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYD
PRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRT
TMRSFKLLDQMETPL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

CTSG protein (Cathepsin G) contains a PF00089 domain.

CTSG protein (Cathepsin G) is proteolytically cut by dipeptidyl-peptidase I (C01.070) cleavage. GE-IIGG.