Receptor-interacting serine/threonine-protein kinase 1

UniProt : Q13546, UniProt ID: RIPK1_HUMAN,

Receptor-interacting serine/threonine-protein kinase 1

Homo sapiens

MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEAL
LEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIIL
EIIEGMCYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVD
GTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMC
IKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLEESVEED
VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFA
PSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPF
AQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLD
PGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQ
IGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKN
CARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRID
LLSSLIYVSQN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Receptor-interacting serine/threonine-protein kinase 1 contains a PF00531 domain.

Receptor-interacting serine/threonine-protein kinase 1 contains a PF00069 domain.

Receptor-interacting serine/threonine-protein kinase 1 is proteolytically cut by caspase-8 (C14.009) cleavage. LQLD-CVAV.

Receptor-interacting serine/threonine-protein kinase 1 is proteolytically cut by caspase-8 (C14.009) cleavage. LQLD-CVAV.

Receptor-interacting serine/threonine-protein kinase 1 is proteolytically cut by caspase-8 (C14.009) cleavage. LQLD-CVAV.

Receptor-interacting serine/threonine-protein kinase 1 is proteolytically cut by caspase-8 (C14.009) cleavage. LQLD-CVAV.

Receptor-interacting serine/threonine-protein kinase 1 is proteolytically cut by caspase-8 (C14.009) cleavage. LQLD-CVAV.