Putative uncharacterized protein

UniProt : P16014, Q3TY66, UniProt ID: Q3TY66_MOUSE, SCG1_MOUSE,

Putative uncharacterized protein

Mus musculus

MQPAMLLGLLGAAALAAVSSAPVDNRDHNEEMVTRCIIEVLSNALSKSSVPTITPECRQV
LKKSGKEVKGEEKGENQNSKFEVRLLRDPADASGTRWASSREDAGAPVEDSQGQTKVGNE
KWTEGGGHSREGVDDQESLRPSNQQASKEAKIYHSEERVGKEREKEEGKIYPMGEHREDA
GEEKKHIEDSGEKPNTFSNKRSEASAKKKDESVARADAHSMELEEKTHSREQSSQESGEE
TRRQEKPQELTDQDQSQEESQEGEEGEEGEEGEEGEEDSASEVTKRRPRHHHGRSGSNKS
SYEGHPLSEERRPSPKESKEADVATVRLGEKRSHHLAHYRASEEEPEYGEESRSYRGLQY
RGRGSEEDRAPRPRSEESQEREYKRNHPDSELESTANRHGEETEEERSYEGANGRQHRGR
GREPGAHSALDTREEKRLLDEGHYPVRESPIDTAKRYPQSKWQEQEKNYLNYGEEGDQGR
WWQQEEQLGPEESREEVRFPDRQYEPYPITEKRKRLGALFNPYFDPLQWKNSDFEKRGNP
DDSFLEDEGEDRNGVTLTEKNSFPEYNYDWWERRPFSEDVNWGYEKRSFARAPQLDLKRQ
YDGVAELDQLLHYRKKADEFPDFYDSEEQMGPHQEANDEKARADQRVLTAEEKKELENLA
AMDLELQKIAEKFSQRG

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF01271 domain.

Putative uncharacterized protein is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. WERR-PFSE.

Putative uncharacterized protein is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. WERR-PFSE.

Putative uncharacterized protein is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. YEKR-SFAR.

Putative uncharacterized protein is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. YEKR-SFAR.