Potassium channel interacting protein 3 (Kv channel interacting protein 3, calsenilin, isoform CRA_b) (cDNA, FLJ96493, Homo sapiens calsenilin, presenilin binding protein, EF handtranscription factor (CSEN), mRNA)

UniProt : Q3YAC4, Q9Y2W7, UniProt ID: CSEN_HUMAN, Q3YAC4_HUMAN,

Potassium channel interacting protein 3 (Kv channel interacting protein 3, calsenilin, isoform CRA_b) (cDNA, FLJ96493, Homo sapiens calsenilin, presenilin binding protein, EF handtranscription factor (CSEN), mRNA)

Homo sapiens

MQPAKEVTKASDGSLLGDLGHTPLSKKEGIKWQRPRLSRQALMRCCLVKWILSSTAPQGS
DSSDSELELSTVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYAQ
FFPQGDATTYAHFLFNAFDADGNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDG
YITKEEMLAIMKSIYDMMGRHTYPILREDAPAEHVERFFEKMDRNQDGVVTIEEFLEACQ
KDENIMSSMQLFENVI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Potassium channel interacting protein 3 (Kv channel interacting protein 3, calsenilin, isoform CRA_b) (cDNA, FLJ96493, Homo sapiens calsenilin, presenilin binding protein, EF handtranscription factor (CSEN), mRNA) contains a PF00036 domain.

Potassium channel interacting protein 3 (Kv channel interacting protein 3, calsenilin, isoform CRA_b) (cDNA, FLJ96493, Homo sapiens calsenilin, presenilin binding protein, EF handtranscription factor (CSEN), mRNA) contains a PF00036 domain.

Potassium channel interacting protein 3 (Kv channel interacting protein 3, calsenilin, isoform CRA_b) (cDNA, FLJ96493, Homo sapiens calsenilin, presenilin binding protein, EF handtranscription factor (CSEN), mRNA) contains a PF00036 domain.

Potassium channel interacting protein 3 (Kv channel interacting protein 3, calsenilin, isoform CRA_b) (cDNA, FLJ96493, Homo sapiens calsenilin, presenilin binding protein, EF handtranscription factor (CSEN), mRNA) is proteolytically cut by caspase-3 (C14.003) cleavage. QGSD-SSDS.

Potassium channel interacting protein 3 (Kv channel interacting protein 3, calsenilin, isoform CRA_b) (cDNA, FLJ96493, Homo sapiens calsenilin, presenilin binding protein, EF handtranscription factor (CSEN), mRNA) is proteolytically cut by caspase-3 (C14.003) cleavage. QGSD-SSDS.

Potassium channel interacting protein 3 (Kv channel interacting protein 3, calsenilin, isoform CRA_b) (cDNA, FLJ96493, Homo sapiens calsenilin, presenilin binding protein, EF handtranscription factor (CSEN), mRNA) is proteolytically cut by caspase-3 (C14.003) cleavage. DSSD-SELE.