Matrix metalloproteinase-26
|
UniProt : Q9NRE1, UniProt ID: MMP26_HUMAN, Matrix metalloproteinase-26 Homo sapiens MQLVILRVTIFLPWCFAVPVPPAADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQ FHRNGTDLLDMQMHALLHQPHCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAV KDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSG NPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQL SADDIQRIQHLYGEKCSSDIP The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Matrix metalloproteinase-26 contains a PF00413 domain.
Matrix metalloproteinase-26 is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. SPLL-TQET.
Matrix metalloproteinase-26 is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. QLLQ-QFHR.
Matrix metalloproteinase-26 is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. QMHA-LLHQ.
Matrix metalloproteinase-26 is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. SPLL-TQET.
Matrix metalloproteinase-26 is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. QLLQ-QFHR.
Matrix metalloproteinase-26 is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. QMHA-LLHQ.
Matrix metalloproteinase-26 is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. SPLL-TQET.
Matrix metalloproteinase-26 is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. QMHA-LLHQ.
Matrix metalloproteinase-26 is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. QLLQ-QFHR.