Matrix metalloproteinase-26

UniProt : Q9NRE1, UniProt ID: MMP26_HUMAN,

Matrix metalloproteinase-26

Homo sapiens

MQLVILRVTIFLPWCFAVPVPPAADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQ
FHRNGTDLLDMQMHALLHQPHCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAV
KDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSG
NPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQL
SADDIQRIQHLYGEKCSSDIP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Matrix metalloproteinase-26 contains a PF00413 domain.

Matrix metalloproteinase-26 is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. SPLL-TQET.

Matrix metalloproteinase-26 is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. QLLQ-QFHR.

Matrix metalloproteinase-26 is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. QMHA-LLHQ.

Matrix metalloproteinase-26 is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. SPLL-TQET.

Matrix metalloproteinase-26 is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. QLLQ-QFHR.

Matrix metalloproteinase-26 is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. QMHA-LLHQ.

Matrix metalloproteinase-26 is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. SPLL-TQET.

Matrix metalloproteinase-26 is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. QMHA-LLHQ.

Matrix metalloproteinase-26 is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. QLLQ-QFHR.