Toxin-coregulated pilin (Toxin-regulated pilus subunit)

UniProt : Q60153, Q7BGC8, UniProt ID: Q7BGC8_VIBCH, TCPA1_VIBCH,

Toxin-coregulated pilin (Toxin-regulated pilus subunit)

Vibrio cholerae

MQLLKQLFKKKFVKEEHDKKTGQEGMTLLEVIIVLGIMGVVSAGVVTLAQRAIDSQNMTK
AAQNLNSVQIAMTQTYRSLGNYPATANANAATQLANGLVSLGKVSADEAKNPFTGTAMGI
FSFPRNSAANKAFAITVGGLTQAQCKTLVTSVGDMFPFINVKEGAFAAVADLGDFETSVA
DAATGAGVIKSIAPGSANLNLTNITHVEKLCTGTAPFTVAFGNS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Toxin-coregulated pilin (Toxin-regulated pilus subunit) contains a PF05946 domain.

Toxin-coregulated pilin (Toxin-regulated pilus subunit) contains a PF07963 domain.

Toxin-coregulated pilin (Toxin-regulated pilus subunit) is proteolytically cut by type 4 prepilin peptidase 1 (A24.001) cleavage. GQEG-MTLL.