ADR322Wp

UniProt : Q759F4, UniProt ID: Q759F4_ASHGO,

ADR322Wp

Ashbya gossypii

MQLKPFVFLAVLPVSSAIPTHKHRRHRRDSQGHLTMTATPFLAADVERQMSPTPGVESSS
VWANTSRYASGSESVSEAVSDGTSTFVSDSFTESESSEGNGTLIADFETLESDTSIGNAT
MAPESISSVSFSSASDADVSAFPTANVSGTAPLSDISSVSESVASSSTLAGDVTLNTSTP
VLSSTAEPSDTNLSSTSAGWLSSISTAVWGSSTDVSSTSSAYPSASSRPKNTTGPSDIHG
DLQNFEPPTQKFVDGSVSCDEFPVGQGVVDLSWVGLGGWASVMDMDGSTAEGCKDGFYCS
YACQAGMSKTQWPSSQPGDGRSVGGLYCKDGKLHRSNPGADYLCQWDVDSAAAVNKVGQP
IAMCRTDYPASENMVVPTVLEPGSSKPVSVVDANNYYMWQGKKTSTQYYVNNAGVSVEDG
CVWGENGSGIGNWAPVVLGAGYDNGISYLSIIPNPNNKVPPNYNVRIVASPGSKVIGDCK
YENGVYNGEGTDGCTVSVLSGTANFEFY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

ADR322Wp contains a PF03856 domain.

ADR322Wp is proteolytically cut by kexin (S08.070) cleavage. RHRR-DSQG.