A-kinase anchor protein 11

UniProt : Q62924, UniProt ID: AKA11_RAT,

A-kinase anchor protein 11

Rattus norvegicus

MQKMQCHLRRPLHSSSSFSSQAVMMTKPMQEHKKEYTAQQALFRPSGIVTSIPVPLAGSA
LLPYHVSSTLYQSKSLSSSEHNKANGGSPQEHIAMESSAEEVDCFKNTCLPSELSPCSQN
DFKPTNGDIDMQSPSKLMSGSMIISNFSTAMVHTIVNETLESMTSFKATKPVDTNADYLT
KTIKGKPVLSLCDQAAPQQNKASSKDMFAEHLSKSIIKHSLDKSKSVLPNIDKKPVSKEH
MLVLGEESQLTLGETPKFLDFSDNSPQYCVPECKDSVGFGFSLEALPPCSMMTSQKSDLK
GVMKDKVVTRHNLTNTAFEPLSFGQESSFRPSQTLSSAVLTCVDSLHVEDKQKIRDRNVI
PDTPPSTPLVPSQTSSEWDIKKLTKQLKGELAKEFAPATPPSTPHNSSVGSLSENEQTTI
EKEEFMLKLMRSLSEEVESSEGEEHPEMDVKSEHSGKKGQFADALATHIISLATEVAASH
LDHEITQEFKVQNSHLTVPSQRSMLPALSHSDESIQTCSFASDMAAGVIAEAEKVANTRS
CMLFGHERTICHVEGDRGKAEEKLDVEDIAHPREVETCVLSLPSCMPGLTYKYPSCESVT
DEYAGHIIQVLKQEGGNSELIMDQYASRLAYRSVKSGVREAAKTVKVKCSLKLFPMHTSH
VKTNKELLFSSKEHHQEVDKKRQRKKYGSHPCKYQTCDRTQDPCRNELSELYRFSASLAS
SITRDVKKQLTAPKVDLPKSSTDCCLFEKSECVDNRENVTGPEFSKSCQPLQNHGLCQNT
SSLSGYSCGESAHTVEQYARKVVGDTLELSLGPAVFLNSETTTSPDRITYAEKLSPLINE
ACRYCDLKESHGCIRNSAQLFSKQGPCASAKPSSHSKLSSIRQKSRIFHLDVPQIHLNLD
KRAVLAEKIVAEAIEKAERELSNTSLAADSGIGQDGISFAESLTTEIMTTAMTNAGHAVS
SSKEVEDFQSTESLGSQQMNLSVGEDSTGSWSNLSFEDDHQDESSSFHHLSESSNGNSSS
WSSLGLEGDLYENNLSFPTSDSDGPDDRESEQEDGAEGLQPSGKTLLIVNIDVEPGAVDP
QLRVILQWLIPRRRKLENFIFSTLQRRSLSYFQSSYRREDGKWAMSCRL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

A-kinase anchor protein 11 is proteolytically cut by calpain-2 (C02.002) cleavage..

A-kinase anchor protein 11 is proteolytically cut by caspase-3 (C14.003) cleavage..