AAL179Wp

UniProt : Q75FB0, UniProt ID: Q75FB0_ASHGO,

AAL179Wp

Ashbya gossypii

MQISAVALSGAALLACASAHQHDRKKPHLVVVYGDVYVSGTDTFTKYYSKMTDKLPASGS
DGWSYSWSTATSWTSDSVSTEPSAEPTSTEPTNLPEVTSSPATPVQPTSAPEETFEEPTE
STSAEPTSSPEPVKSAEPTSSPEPVKSVEPTSSPEPVKSVEPVKSAEPVKSPEPVKSPEP
VKSPEPVKSPEPVKSAEPTSSPEPTGSPQRSRPAGGQNGASFEEEILRAHNSRRQLHKDT
KPLTWSEELAKFARDFANQYDCSGRLVHSDSPYGENLAVGYPTPEKAVKAWYDEISDYSY
SHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGSVGDYLICSYDPAGNFLRRFGENVAPIA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

AAL179Wp contains a PF00188 domain.

AAL179Wp is proteolytically cut by kexin (S08.070) cleavage. NSRR-QLHK.