A disintegrin and metalloproteinase with thrombospondin motifs 9

UniProt : Q9P2N4, UniProt ID: ATS9_HUMAN,

A disintegrin and metalloproteinase with thrombospondin motifs 9

Homo sapiens

MQFVSWATLLTLLVRDLAEMGSPDAAAAVRKDRLHPRQVKLLETLSEYEIVSPIRVNALG
EPFPTNVHFKRTRRSINSATDPWPAFASSSSSSTSSQAHYRLSAFGQQFLFNLTANAGFI
APLFTVTLLGTPGVNQTKFYSEEEAELKHCFYKGYVNTNSEHTAVISLCSGMLGTFRSHD
GDYFIEPLQSMDEQEDEEEQNKPHIIYRRSAPQREPSTGRHACDTSEHKNRHSKDKKKTR
ARKWGERINLAGDVAALNSGLATEAFSAYGNKTDNTREKRTHRRTKRFLSYPRFVEVLVV
ADNRMVSYHGENLQHYILTLMSIVASIYKDPSIGNLINIVIVNLIVIHNEQDGPSISFNA
QTTLKNFCQWQHSKNSPGGIHHDTAVLLTRQDICRAHDKCDTLGLAELGTICDPYRSCSI
SEDSGLSTAFTIAHELGHVFNMPHDDNNKCKEEGVKSPQHVMAPTLNFYTNPWMWSKCSR
KYITEFLDTGYGECLLNEPESRPYPLPVQLPGILYNVNKQCELIFGPGSQVCPYMMQCRR
LWCNNVNGVHKGCRTQHTPWADGTECEPGKHCKYGFCVPKEMDVPVTDGSWGSWSPFGTC
SRTCGGGIKTAIRECNRPEPKNGGKYCVGRRMKFKSCNTEPCLKQKRDFRDEQCAHFDGK
HFNINGLLPNVRWVPKYSGILMKDRCKLFCRVAGNTAYYQLRDRVIDGTPCGQDTNDICV
QGLCRQAGCDHVLNSKARRDKCGVCGGDNSSCKTVAGTFNTVHYGYNTVVRIPAGATNID
VRQHSFSGETDDDNYLALSSSKGEFLLNGNFVVTMAKREIRIGNAVVEYSGSETAVERIN
STDRIEQELLLQVLSVGKLYNPDVRYSFNIPIEDKPQQFYWNSHGPWQACSKPCQGERKR
KLVCTRESDQLTVSDQRCDRLPQPGHITEPCGTDCDLRWHVASRSECSAQCGLGYRTLDI
YCAKYSRLDGKTEKVDDGFCSSHPKPSNREKCSGECNTGGWRYSAWTECSKSCDGGTQRR
RAICVNTRNDVLDDSKCTHQEKVTIQRCSEFPCPQWKSGDWSECLVTCGKGHKHRQVWCQ
FGEDRLNDRMCDPETKPTSMQTCQQPECASWQAGPWGQCSVTCGQGYQLRAVKCIIGTYM
SVVDDNDCNAATRPTDTQDCELPSCHPPPAAPETRRSTYSAPRTQWRFGSWTPCSATCGK
GTRMRYVSCRDENGSVADESACATLPRPVAKEECSVTPCGQWKALDWSSCSVTCGQGRAT
RQVMCVNYSDHVIDRSECDQDYIPETDQDCSMSPCPQRTPDSGLAQHPFQNEDYRPRSAS
PSRTHVLGGNQWRTGPWGACSSTCAGGSQRRVVVCQDENGYTANDCVERIKPDEQRACES
GPCPQWAYGNWGECTKLCGGGIRTRLVVCQRSNGERFPDLSCEILDKPPDREQCNTHACP
HDAAWSTGPWSSCSVSCGRGHKQRNVYCMAKDGSHLESDYCKHLAKPHGHRKCRGGRCPK
WKAGAWSQCSVSCGRGVQQRHVGCQIGTHKIARETECNPYTRPESERDCQGPRCPLYTWR
AEEWQECTKTCGEGSRYRKVVCVDDNKNEVHGARCDVSKRPVDRESCSLQPCEYVWITGE
WSECSVTCGKGYKQRLVSCSEIYTGKENYEYSYQTTINCPGTQPPSVHPCYLRDCPVSAT
WRVGNWGSCSVSCGVGVMQRSVQCLTNEDQPSHLCHTDLKPEERKTCRNVYNCELPQNCK
EVKRLKGASEDGEYFLMIRGKLLKIFCAGMHSDHPKEYVTLVHGDSENFSEVYGHRLHNP
TECPYNGSRRDDCQCRKDYTAAGFSSFQKIRIDLTSMQIITTDLQFARTSEGHPVPFATA
GDCYSAAKCPQGRFSINLYGTGLSLTESARWISQGNYAVSDIKKSPDGTRVVGKCGGYCG
KCTPSSGTGLEVRVL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

A disintegrin and metalloproteinase with thrombospondin motifs 9 contains a PF00090 domain.

A disintegrin and metalloproteinase with thrombospondin motifs 9 contains a PF00090 domain.

A disintegrin and metalloproteinase with thrombospondin motifs 9 contains a PF00090 domain.

A disintegrin and metalloproteinase with thrombospondin motifs 9 contains a PF00090 domain.

A disintegrin and metalloproteinase with thrombospondin motifs 9 contains a PF00090 domain.

A disintegrin and metalloproteinase with thrombospondin motifs 9 contains a PF00090 domain.

A disintegrin and metalloproteinase with thrombospondin motifs 9 contains a PF00090 domain.

A disintegrin and metalloproteinase with thrombospondin motifs 9 contains a PF00090 domain.

A disintegrin and metalloproteinase with thrombospondin motifs 9 contains a PF00090 domain.

A disintegrin and metalloproteinase with thrombospondin motifs 9 contains a PF00090 domain.

A disintegrin and metalloproteinase with thrombospondin motifs 9 contains a PF00090 domain.

A disintegrin and metalloproteinase with thrombospondin motifs 9 contains a PF00090 domain.

A disintegrin and metalloproteinase with thrombospondin motifs 9 contains a PF00090 domain.

A disintegrin and metalloproteinase with thrombospondin motifs 9 contains a PF01421 domain.

A disintegrin and metalloproteinase with thrombospondin motifs 9 contains a PF01562 domain.

A disintegrin and metalloproteinase with thrombospondin motifs 9 contains a PF05986 domain.

A disintegrin and metalloproteinase with thrombospondin motifs 9 contains a PF08685 domain.

A disintegrin and metalloproteinase with thrombospondin motifs 9 is proteolytically cut by furin (S08.071) cleavage. RTKR-FLSY.