Similar to uniprot|P47001 Saccharomyces cerevisiae YJL158c CIS3

UniProt : Q6FQH6, UniProt ID: Q6FQH6_CANGA,

Similar to uniprot|P47001 Saccharomyces cerevisiae YJL158c CIS3

Candida glabrata

MQFKNVALTAAVASVAAADGYTPGNPWSTLTPSGTVACAKPEYTASFGIAVKPISSSVAK
RAVVSQIGDGQIQATSAAPKPTNAAASQVADGQVQQKTTSTTKATTTLAPSSSKTSSTST
STSCAATPLTIKESSCKNDGTLQLTLKGGVLTDGKGRVGSIVSNRQFQFDGPPPQAGAIY
AGGWSITEQGNLALGNSDVFYQCLSGNFYNLYDQKIAEQCSPINLEVVSLVDC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Similar to uniprot|P47001 Saccharomyces cerevisiae YJL158c CIS3 contains a PF00399 domain.

Similar to uniprot|P47001 Saccharomyces cerevisiae YJL158c CIS3 contains a PF00399 domain.

Similar to uniprot|P47001 Saccharomyces cerevisiae YJL158c CIS3 is proteolytically cut by kexin (S08.070) cleavage. VAKR-AVVS.