cDNA FLJ76287, highly similar to Homo sapiens phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 1, mRNA (Phospholipase A2, group VI (Cytosolic, calcium-independent), isoform CRA_b)

UniProt : A8K597, O60733, UniProt ID: A8K597_HUMAN, PA2G6_HUMAN,

cDNA FLJ76287, highly similar to Homo sapiens phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 1, mRNA (Phospholipase A2, group VI (Cytosolic, calcium-independent), isoform CRA_b)

Homo sapiens

MQFFGRLVNTFSGVTNLFSNPFRVKEVAVADYTSSDRVREEGQLILFQNTPNRTWDCVLV
NPRNSQSGFRLFQLELEADALVNFHQYSSQLLPFYESSPQVLHTEVLQHLTDLIRNHPSW
SVAHLAVELGIRECFHHSRIISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMD
VTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLL
LCNARCNIMGPNGYPIHSAMKFSQKGCAEMIISMDSSQIHSKDPRYGASPLHWAKNAEMA
RMLLKRGCNVNSTSSAGNTALHVAVMRNRFDCAIVLLTHGANADARGEHGNTPLHLAMSK
DNVEMIKALIVFGAEVDTPNDFGETPTFLASKIGRLVTRKAILTLLRTVGAEYCFPPIHG
VPAEQGSAAPHHPFSLERAQPPPISLNNLELQDLMHISRARKPAFILGSMRDEKRTHDHL
LCLDGGGVKGLIIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAILHSKSMAYMRGM
YFRMKDEVFRGSRPYESGPLEEFLKREFGEHTKMTDVRKPKVMLTGTLSDRQPAELHLFR
NYDAPETVREPRFNQNVNLRPPAQPSDQLVWRAARSSGAAPTYFRPNGRFLDGGLLANNP
TLDAMTEIHEYNQDLIRKGQANKVKKLSIVVSLGTGRSPQVPVTCVDVFRPSNPWELAKT
VFGAKELGKMVVDCCTDPDGRAVDRARAWCEMVGIQYFRLNPQLGTDIMLDEVSDTVLVN
ALWETEVYIYEHREEFQKLIQLLLSP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ76287, highly similar to Homo sapiens phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 1, mRNA (Phospholipase A2, group VI (Cytosolic, calcium-independent), isoform CRA_b) contains a PF00023 domain.

cDNA FLJ76287, highly similar to Homo sapiens phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 1, mRNA (Phospholipase A2, group VI (Cytosolic, calcium-independent), isoform CRA_b) contains a PF00023 domain.

cDNA FLJ76287, highly similar to Homo sapiens phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 1, mRNA (Phospholipase A2, group VI (Cytosolic, calcium-independent), isoform CRA_b) contains a PF00023 domain.

cDNA FLJ76287, highly similar to Homo sapiens phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 1, mRNA (Phospholipase A2, group VI (Cytosolic, calcium-independent), isoform CRA_b) contains a PF00023 domain.

cDNA FLJ76287, highly similar to Homo sapiens phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 1, mRNA (Phospholipase A2, group VI (Cytosolic, calcium-independent), isoform CRA_b) contains a PF00023 domain.

cDNA FLJ76287, highly similar to Homo sapiens phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 1, mRNA (Phospholipase A2, group VI (Cytosolic, calcium-independent), isoform CRA_b) contains a PF01734 domain.

cDNA FLJ76287, highly similar to Homo sapiens phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 1, mRNA (Phospholipase A2, group VI (Cytosolic, calcium-independent), isoform CRA_b) contains a PF00023 domain.

cDNA FLJ76287, highly similar to Homo sapiens phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 1, mRNA (Phospholipase A2, group VI (Cytosolic, calcium-independent), isoform CRA_b) is proteolytically cut by caspase-3 (C14.003) cleavage. DVTD-YKGE.