Somatostatin-2

UniProt : P01170, UniProt ID: SMS2_LOPAM,

Somatostatin-2

Lophius americanus

MQCIRCPAILALLALVLCGPSVSSQLDREQSDNQDLDLELRQHWLLERARSAGLLSQEWS
KRAVEELLAQMSLPEADVQREAEDASMATGGRMNLERSVDSTNNLPPRERKAGCKNFYWK
GFTSC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Somatostatin-2 contains a PF03002 domain.

Somatostatin-2 is proteolytically cut by yapsin 3 (A01.035) cleavage. NLER-SVDS.

Somatostatin-2 is proteolytically cut by yapsin 1 (A01.030) cleavage. NLER-SVDS.