Putative uncharacterized protein (Fragment)

UniProt : P21246, Q6ICQ5, UniProt ID: PTN_HUMAN, Q6ICQ5_HUMAN,

Putative uncharacterized protein (Fragment)

Homo sapiens

MQAQQYQQQRRKFAAAFLAFIFILAAVDTAEAGKKEKPEKKVKKSDCGEWQWSVCVPTSG
DCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTG
SLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein (Fragment) contains a PF01091 domain.

Putative uncharacterized protein (Fragment) contains a PF05196 domain.

Putative uncharacterized protein (Fragment) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. KPKP-QAES.

Putative uncharacterized protein (Fragment) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. IPCN-WKKQ.