MGC80698 protein

UniProt : Q6GP43, UniProt ID: Q6GP43_XENLA,

MGC80698 protein

Xenopus laevis

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWYPEVRHHCPSTPIILVGTKLDLR
DDKETIEKLKEKKLSPISYPQGLALAKEIESVKYLECSALTQRGLKTVFDEAIRAVLCPP
PSRPKKGKCVVL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

MGC80698 protein contains a PF00071 domain.

MGC80698 protein is proteolytically cut by oviductin (S01.240) cleavage. SGSR-WNQK.