Isoform B of Ras-related C3 botulinum toxin substrate 1

UniProt : A4D2P0, P63000, UniProt ID: A4D2P0_HUMAN, P63000-2,

Isoform B of Ras-related C3 botulinum toxin substrate 1

Homo sapiens

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTVGETYGKDITSRGKDKPIADVFLICFSLVSPASFENVRAKWYPEV
RHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALT
QRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform B of Ras-related C3 botulinum toxin substrate 1 contains a PF00071 domain.

Isoform B of Ras-related C3 botulinum toxin substrate 1 is proteolytically cut by YopT peptidase (C58.001) cleavage. RKRK-CLLL.