Isoform Er5 of Ankyrin-1

UniProt : P16157, UniProt ID: P16157-3,

Isoform Er5 of Ankyrin-1

Homo sapiens

MPYSVGFREADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKM
VVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQ
ENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIA
ARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGI
TPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQA
KTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDK
GAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIV
KNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARI
GHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPL
HVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAW
NGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQAN
GNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFL
LQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYI
SVTDVLKVVTDETSFVLVSDKHRMSFPETVDEILDVSEDEGEELISFKAERRDSRDVDEE
KELLDFVPKLDQVVESPAIPRIPCAMPETVVIRSEEQEQASKEYDEDSLIPSSPATETSD
NISPVASPVHTGFLVSFMVDARGGSMRGSRHNGLRVVIPPRTCAAPTRITCRLVKPQKLS
TPPPLAEEEGLASRIIALGPTGAQFLSPVIVEIPHFASHGRGDRELVVLRSENGSVWKEH
RSRYGESYLDQILNGMDEELGSLEELEKKRVCRIITTDFPLYFVIMSRLCQDYDTIGPEG
GSLKSKLVPLVQATFPENAVTKRVKLALQAQPVPDELVTKLLGNQATFSPIVTVEPRRRK
FHRPIGLRIPLPPSWTDNPRDSGEGDTTSLRLLCSVIGGTDQAQWEDITGTTKLVYANEC
ANFTTNVSARFWLSDCPRTAEAVNFATLLYKELTAVPYMAKFVIFAKMNDPREGRLRCYC
MTDDKVDKTLEQHENFVEVARSRDIEVLEGMSLFAELSGNLVPVKKAAQQRSFHFQSFRE
NRLAMPVKVRDSSREPGGSLSFLRKAMKYEDTQHILCHLNITMPPCAKGSGAEDRRRTPT
PLALRYSILSESTPGSLSGTEQAEMKMAVISEHLGLSWAELARELQFSVEDINRIRVENP
NSLLEQSVALLNLWVIREGQNANMENLYTALQSIDRGEIVNMLEGSGRQSRNLKPDRRHT
DRDYSLSPSQMNGYSSLQDELLSPASLGCALSSPLRADQYWNEVAVLDAIPLAATEHDTM
LEMSDMQVWSAGLTPSLVTAEDSSLECSKAEDSDATGHEWKLEGALSEEPRGPELGSLEL
VEDDTVDSDATNGLIDLLEQEEGQRSEEKLPGSKRQDDATGAGQDSENEVSLVSGHQRGQ
ARITHSPTVSQVTERSQDRLQDWDADGSIVSYLQDAAQGSWQEEVTQGPHSFQGTSTMTE
GLEPGGSQEYEKVLVSVSEHTWTEQPEAESSQADRDRRQQGQEEQVQEAKNTFTQVVQGN
EFQNIPGEQVTEEQFTDEQGNIVTKKIIRKVVRQIDLSSADAAQEHEEVELRGSGLQPDL
IEGRKGAQIVKRASLKRGKQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform Er5 of Ankyrin-1 contains a PF00023 domain.

Isoform Er5 of Ankyrin-1 contains a PF00791 domain.

Isoform Er5 of Ankyrin-1 contains a PF00531 domain.

Isoform Er5 of Ankyrin-1 contains a PF00023 domain.

Isoform Er5 of Ankyrin-1 contains a PF00023 domain.

Isoform Er5 of Ankyrin-1 contains a PF00023 domain.

Isoform Er5 of Ankyrin-1 contains a PF00023 domain.

Isoform Er5 of Ankyrin-1 contains a PF00023 domain.

Isoform Er5 of Ankyrin-1 contains a PF00023 domain.

Isoform Er5 of Ankyrin-1 contains a PF00023 domain.

Isoform Er5 of Ankyrin-1 contains a PF00023 domain.

Isoform Er5 of Ankyrin-1 contains a PF00023 domain.

Isoform Er5 of Ankyrin-1 contains a PF00023 domain.

Isoform Er5 of Ankyrin-1 contains a PF00023 domain.

Isoform Er5 of Ankyrin-1 contains a PF00023 domain.

Isoform Er5 of Ankyrin-1 contains a PF00023 domain.

Isoform Er5 of Ankyrin-1 contains a PF00023 domain.

Isoform Er5 of Ankyrin-1 contains a PF00023 domain.

Isoform Er5 of Ankyrin-1 contains a PF00023 domain.

Isoform Er5 of Ankyrin-1 contains a PF00023 domain.

Isoform Er5 of Ankyrin-1 contains a PF00023 domain.

Isoform Er5 of Ankyrin-1 contains a PF00023 domain.

Isoform Er5 of Ankyrin-1 contains a PF00023 domain.

Isoform Er5 of Ankyrin-1 contains a PF00023 domain.

Isoform Er5 of Ankyrin-1 contains a PF00023 domain.

Isoform Er5 of Ankyrin-1 is proteolytically cut by falcipain-2 (C01.046) cleavage..