KLLA0D02442p

UniProt : Q6CSB2, UniProt ID: Q6CSB2_KLULA,

KLLA0D02442p

Kluyveromyces lactis

MPWQCRHTLRRCLAFVYLAFLLYSRIYFLTYIYVLIFFAGFKISWFKASIYITRGLISFC
LRLKHQARFIFFKEPVPSFVTMKLSNATLLSLAATAIAAPVATVTVHEHVRHTVIVEGYV
YIDGTTTSTGYRTVNGQSVETAAPATETDTAAFVTQVVAAGAAASPSSQAVAAEYVSDED
TTTTGAPSTTSTAEQTTLTPTPTIEQTATSTPATTTAATSSSSSDSNLSSFASSMLDEHN
AKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLTHSGGPYGENLAIGYGTTGAVDAWY
SEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGVWGDYIICSYDPAGNMLGTF
ASNVEPLA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

KLLA0D02442p contains a PF00188 domain.

KLLA0D02442p is proteolytically cut by kexin (S08.070) cleavage. NAKR-ALHK.