Pro-epidermal growth factor

UniProt : P01132, UniProt ID: EGF_MOUSE,

Pro-epidermal growth factor

Mus musculus

MPWGRRPTWLLLAFLLVFLKISILSVTAWQTGNCQPGPLERSERSGTCAGPAPFLVFSQG
KSISRIDPDGTNHQQLVVDAGISADMDIHYKKERLYWVDVERQVLLRVFLNGTGLEKVCN
VERKVSGLAIDWIDDEVLWVDQQNGVITVTDMTGKNSRVLLSSLKHPSNIAVDPIERLMF
WSSEVTGSLHRAHLKGVDVKTLLETGGISVLTLDVLDKRLFWVQDSGEGSHAYIHSCDYE
GGSVRLIRHQARHSLSSMAFFGDRIFYSVLKSKAIWIANKHTGKDTVRINLHPSFVTPGK
LMVVHPRAQPRTEDAAKDPDPELLKQRGRPCRFGLCERDPKSHSSACAEGYTLSRDRKYC
EDVNECATQNHGCTLGCENTPGSYHCTCPTGFVLLPDGKQCHELVSCPGNVSKCSHGCVL
TSDGPRCICPAGSVLGRDGKTCTGCSSPDNGGCSQICLPLRPGSWECDCFPGYDLQSDRK
SCAASGPQPLLLFANSQDIRHMHFDGTDYKVLLSRQMGMVFALDYDPVESKIYFAQTALK
WIERANMDGSQRERLITEGVDTLEGLALDWIGRRIYWTDSGKSVVGGSDLSGKHHRIIIQ
ERISRPRGIAVHPRARRLFWTDVGMSPRIESASLQGSDRVLIASSNLLEPSGITIDYLTD
TLYWCDTKRSVIEMANLDGSKRRRLIQNDVGHPFSLAVFEDHLWVSDWAIPSVIRVNKRT
GQNRVRLQGSMLKPSSLVVVHPLAKPGADPCLYRNGGCEHICQESLGTARCLCREGFVKA
WDGKMCLPQDYPILSGENADLSKEVTSLSNSTQAEVPDDDGTESSTLVAEIMVSGMNYED
DCGPGGCGSHARCVSDGETAECQCLKGFARDGNLCSDIDECVLARSDCPSTSSRCINTEG
GYVCRCSEGYEGDGISCFDIDECQRGAHNCAENAACTNTEGGYNCTCAGRPSSPGRSCPD
STAPSLLGEDGHHLDRNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQT
RDLRWWELRHAGYGQKHDIMVVAVCMVALVLLLLLGMWGTYYYRTRKQLSNPPKNPCDEP
SGSVSSSGPDSSSGAAVASCPQPWFVVLEKHQDPKNGSLPADGTNGAVVDAGLSPSLQLG
SVHLTSWRQKPHIDGMGTGQSCWIPPSSDRGPQEIEGNSHLPSYRPVGPEKLHSLQSANG
SCHERAPDLPRQTEPVK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Pro-epidermal growth factor contains a PF00008 domain.

Pro-epidermal growth factor contains a PF00008 domain.

Pro-epidermal growth factor contains a PF00008 domain.

Pro-epidermal growth factor contains a PF00058 domain.

Pro-epidermal growth factor contains a PF00058 domain.

Pro-epidermal growth factor contains a PF00058 domain.

Pro-epidermal growth factor contains a PF00058 domain.

Pro-epidermal growth factor contains a PF00058 domain.

Pro-epidermal growth factor contains a PF00058 domain.

Pro-epidermal growth factor contains a PF07645 domain.

Pro-epidermal growth factor contains a PF07645 domain.

Pro-epidermal growth factor contains a PF07645 domain.

Pro-epidermal growth factor contains a PF00058 domain.

Pro-epidermal growth factor contains a PF00008 domain.

Pro-epidermal growth factor contains a PF00008 domain.

Pro-epidermal growth factor is proteolytically cut by ADAM10 peptidase (M12.210) cleavage..

Pro-epidermal growth factor is proteolytically cut by ADAM10 peptidase (M12.210) cleavage..

Pro-epidermal growth factor is proteolytically cut by kallikrein mK9 (S01.071) cleavage. HLDR-NSYP.

Pro-epidermal growth factor is proteolytically cut by kallikrein mK9 (S01.071) cleavage. WELR-HAGY.