DLG1 (Discs, large homolog 1 (Drosophila), isoform CRA_b)

UniProt : A5YKK7, UniProt ID: A5YKK7_HUMAN,

DLG1 (Discs, large homolog 1 (Drosophila), isoform CRA_b)

Homo sapiens

MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTL
LDNPKCIDRSKPSEPIQPVNTWEISSLPSSTVTSETLPSSLSPSVEKYRYQDEDTPPQEH
ISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKPTEAVLPSPPTVPVIPVLP
VPAENTVILPTIPQANPPPVLVNTDSLETPTYVNGTDADYEYEEITLERGNSGLGFSIAG
GTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAG
SIVRLYVKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAH
KDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDIT
NSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGLGFNI
VGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVT
IVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYVRALFDYDKTKDSGL
PSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKF
NSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSYEPVNQQEVNYTRPVIIL
GPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIE
AGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIME
MNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGSYIWVPA
KEKL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

DLG1 (Discs, large homolog 1 (Drosophila), isoform CRA_b) contains a PF00595 domain.

DLG1 (Discs, large homolog 1 (Drosophila), isoform CRA_b) contains a PF00595 domain.

DLG1 (Discs, large homolog 1 (Drosophila), isoform CRA_b) contains a PF09058 domain.

DLG1 (Discs, large homolog 1 (Drosophila), isoform CRA_b) contains a PF00625 domain.

DLG1 (Discs, large homolog 1 (Drosophila), isoform CRA_b) contains a PF00595 domain.

DLG1 (Discs, large homolog 1 (Drosophila), isoform CRA_b) contains a PF00018 domain.

DLG1 (Discs, large homolog 1 (Drosophila), isoform CRA_b) is proteolytically cut by caspase-3 (C14.003) cleavage. QPVD-NHVS.