Calpain-3

UniProt : P16259, UniProt ID: CAN3_RAT,

Calpain-3

Rattus norvegicus

MPTVISPTVAPRTGAEPRSPGPVPHPAQGKTTEAGGGHPGGIYSAIISRNFPIIGVKEKT
FEQLHKKCLEKKVLYLDPEFPPDETSLFYSQKFPIQFVWKRPPEICENPRFIIGGANRTD
ICQGDLGDCWLLAAIACLTLNERLLFRVIPHDQSFTENYAGIFHFQFWRYGDWVDVVIDD
CLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFFE
IKDAPSDMYKIMRKAIERGSLMGCSIDDGTNMTYGTSPSGLNMGELIARMVRNMDNSLLR
DSDLDPRASDDRPSRTIVPVQYETRMACGLVKGHAYSVTGLEEALFKGEKVKLVRLRNPW
GQVEWNGSWSDGWKDWSFVDKDEKARLQHQVTEDGEFWMSYDDFVYHFTKLEICNLTADA
LESDKLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPDDSEVICSF
LVALMQKNRRKDRKLGANLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINM
REVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEAENTISVDRPVKKKKNK
PIIFVSDRANSNKELGVDQEAEEGKDKTGPDKQGESPQPRPGHTDQESEEQQQFRNIFRQ
IAGDDMEICADELKNVLNTVVNKHKDLKTQGFTLESCRSMIALMDTDGSGRLNLQEFHHL
WKKIKAWQKIFKHYDTDHSGTINSYEMRNAVNDAGFHLNSQLYDIITMRYADKHMNIDFD
SFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Calpain-3 contains a PF00036 domain.

Calpain-3 contains a PF00648 domain.

Calpain-3 contains a PF01067 domain.

Calpain-3 contains a PF00036 domain.

Calpain-3 contains a PF00036 domain.

Calpain-3 is proteolytically cut by calpain-3 (C02.004) cleavage. NMTY-GTSP.

Calpain-3 is proteolytically cut by calpain-3 (C02.004) cleavage. NMDN-SLLR.

Calpain-3 is proteolytically cut by calpain-3 (C02.004) cleavage. PVQY-ETRM.

Calpain-3 is proteolytically cut by calpain-3 (C02.004) cleavage. NMTY-GTSP.

Calpain-3 is proteolytically cut by calpain-3 (C02.004) cleavage. NMDN-SLLR.

Calpain-3 is proteolytically cut by calpain-3 (C02.004) cleavage. PVQY-ETRM.

Calpain-3 is proteolytically cut by calpain-3 (C02.004) cleavage. ISVD-RPVK.