Myelencephalon specific protease
|
UniProt : O54854, UniProt ID: O54854_RAT, Myelencephalon specific protease Rattus norvegicus MPTKMLTVKTLALCLILAKSAWSEDQDKVVHGGPCLKNSHPFQAALYTSGHLLCGGVLVG PQWVLTAAHCKKPNLEVYLGKHNLRQTETFQRQISVDRTIVHPRYNPQTHDNDIMMVHLK RPVKFSQRIQPLPLKKDCSEKNPDCQILGWGKMENGEFPDTIQCADVQLVSREECERAYP GKITRSMVCAGDKREGNDSCQGDSGGPLVCGGHLRGIVSWGDMPCGSKEKPGVYTDVCTH IRWIQNIIRNK The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Myelencephalon specific protease contains a PF00089 domain.
Myelencephalon specific protease is proteolytically cut by kallikrein 6 (S01.236) cleavage. HNLR-QTET.
Myelencephalon specific protease is proteolytically cut by kallikrein 6 (S01.236) cleavage. TFQR-QISV.