Myelencephalon specific protease

UniProt : O54854, UniProt ID: O54854_RAT,

Myelencephalon specific protease

Rattus norvegicus

MPTKMLTVKTLALCLILAKSAWSEDQDKVVHGGPCLKNSHPFQAALYTSGHLLCGGVLVG
PQWVLTAAHCKKPNLEVYLGKHNLRQTETFQRQISVDRTIVHPRYNPQTHDNDIMMVHLK
RPVKFSQRIQPLPLKKDCSEKNPDCQILGWGKMENGEFPDTIQCADVQLVSREECERAYP
GKITRSMVCAGDKREGNDSCQGDSGGPLVCGGHLRGIVSWGDMPCGSKEKPGVYTDVCTH
IRWIQNIIRNK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Myelencephalon specific protease contains a PF00089 domain.

Myelencephalon specific protease is proteolytically cut by kallikrein 6 (S01.236) cleavage. HNLR-QTET.

Myelencephalon specific protease is proteolytically cut by kallikrein 6 (S01.236) cleavage. TFQR-QISV.