Alpha-1-antitrypsin

UniProt : P01009, UniProt ID: A1AT_HUMAN,

Alpha-1-antitrypsin

Homo sapiens

MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFS
LYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGF
QELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQ
INDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTV
KVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFL
ENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKA
VLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Alpha-1-antitrypsin contains a PF00079 domain.

Alpha-1-antitrypsin is proteolytically cut by elastase-2 (S01.131) cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by periodontain (C10.003) cleavage. MFLE-AIPM.

Alpha-1-antitrypsin is proteolytically cut by periodontain (C10.003) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by elastase-2 (S01.131) cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by periodontain (C10.003) cleavage. MFLE-AIPM.

Alpha-1-antitrypsin is proteolytically cut by periodontain (C10.003) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. PFVF-LMIE.

Alpha-1-antitrypsin is proteolytically cut by cathepsin L (C01.032) cleavage. MFLE-AIPM.

Alpha-1-antitrypsin is proteolytically cut by cathepsin L (C01.032) cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by mesotrypsin (S01.174) cleavage. AAQK-TDTS.

Alpha-1-antitrypsin is proteolytically cut by glutamyl peptidase I (S01.269) cleavage. MFLE-AIPM.

Alpha-1-antitrypsin is proteolytically cut by adamalysin (M12.141) cleavage. AAGA-MFLE.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by Allergen Der P1 () cleavage. MFLE-AIPM.

Alpha-1-antitrypsin is proteolytically cut by pseudolysin (M04.005) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by papain (C01.001) cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by serralysin (M10.051) cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by pollen endopeptidase () cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by oryzin (S08.053) cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by membrane-type matrix metallopeptidase-6 (M10.024) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by membrane-type matrix metallopeptidase-6 (M10.024) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by elastase-2 (S01.131) cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by periodontain (C10.003) cleavage. MFLE-AIPM.

Alpha-1-antitrypsin is proteolytically cut by periodontain (C10.003) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. PFVF-LMIE.

Alpha-1-antitrypsin is proteolytically cut by cathepsin L (C01.032) cleavage. MFLE-AIPM.

Alpha-1-antitrypsin is proteolytically cut by cathepsin L (C01.032) cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by mesotrypsin (S01.174) cleavage. AAQK-TDTS.

Alpha-1-antitrypsin is proteolytically cut by glutamyl peptidase I (S01.269) cleavage. MFLE-AIPM.

Alpha-1-antitrypsin is proteolytically cut by adamalysin (M12.141) cleavage. AAGA-MFLE.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by Allergen Der P1 () cleavage. MFLE-AIPM.

Alpha-1-antitrypsin is proteolytically cut by pseudolysin (M04.005) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by papain (C01.001) cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by serralysin (M10.051) cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by pollen endopeptidase () cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by oryzin (S08.053) cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by membrane-type matrix metallopeptidase-6 (M10.024) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by membrane-type matrix metallopeptidase-6 (M10.024) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by neutral protease Npr599 () cleavage..

Alpha-1-antitrypsin is proteolytically cut by inhA g.p. (M06.001) cleavage..

Alpha-1-antitrypsin is proteolytically cut by elastase-2 (S01.131) cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by periodontain (C10.003) cleavage. MFLE-AIPM.

Alpha-1-antitrypsin is proteolytically cut by periodontain (C10.003) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. PFVF-LMIE.

Alpha-1-antitrypsin is proteolytically cut by cathepsin L (C01.032) cleavage. MFLE-AIPM.

Alpha-1-antitrypsin is proteolytically cut by cathepsin L (C01.032) cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by mesotrypsin (S01.174) cleavage. AAQK-TDTS.

Alpha-1-antitrypsin is proteolytically cut by glutamyl peptidase I (S01.269) cleavage. MFLE-AIPM.

Alpha-1-antitrypsin is proteolytically cut by adamalysin (M12.141) cleavage. AAGA-MFLE.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by Allergen Der P1 () cleavage. MFLE-AIPM.

Alpha-1-antitrypsin is proteolytically cut by pseudolysin (M04.005) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by papain (C01.001) cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by serralysin (M10.051) cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by pollen endopeptidase () cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by oryzin (S08.053) cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by membrane-type matrix metallopeptidase-6 (M10.024) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by membrane-type matrix metallopeptidase-6 (M10.024) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by neutral protease Npr599 () cleavage..

Alpha-1-antitrypsin is proteolytically cut by inhA g.p. (M06.001) cleavage..

Alpha-1-antitrypsin is proteolytically cut by adamalysin (M12.141) cleavage. AAGA-MFLE.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-18 (M10.018) cleavage. RPFE-VKDT.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. RPFE-VKDT.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-11 (M10.007) cleavage. AAGA-MFLE.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by aureolysin (M04.009) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by pseudolysin (M04.005) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by peptidase 1 (C01.073) cleavage. PQGD-AAQK.

Alpha-1-antitrypsin is proteolytically cut by peptidase 1 (C01.073) cleavage. QKTD-TSHH.

Alpha-1-antitrypsin is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage..

Alpha-1-antitrypsin is proteolytically cut by (M04.022) cleavage. HDQD-HPTF.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. VSLA-EDPQ.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by mesotrypsin (S01.174) cleavage. AAQK-TDTS.

Alpha-1-antitrypsin is proteolytically cut by cysteine proteinase () cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by metalloproteinase () cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by Allergen Der P1 () cleavage. FLEA-IPMS.

Alpha-1-antitrypsin is proteolytically cut by glutamyl peptidase I (S01.269) cleavage. MFLE-AIPM.

Alpha-1-antitrypsin is proteolytically cut by elastase-2 (S01.131) cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by periodontain (C10.003) cleavage. MFLE-AIPM.

Alpha-1-antitrypsin is proteolytically cut by periodontain (C10.003) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. PFVF-LMIE.

Alpha-1-antitrypsin is proteolytically cut by cathepsin L (C01.032) cleavage. MFLE-AIPM.

Alpha-1-antitrypsin is proteolytically cut by cathepsin L (C01.032) cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by mesotrypsin (S01.174) cleavage. AAQK-TDTS.

Alpha-1-antitrypsin is proteolytically cut by glutamyl peptidase I (S01.269) cleavage. MFLE-AIPM.

Alpha-1-antitrypsin is proteolytically cut by adamalysin (M12.141) cleavage. AAGA-MFLE.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by Allergen Der P1 () cleavage. MFLE-AIPM.

Alpha-1-antitrypsin is proteolytically cut by pseudolysin (M04.005) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by papain (C01.001) cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by serralysin (M10.051) cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by pollen endopeptidase () cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by oryzin (S08.053) cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by membrane-type matrix metallopeptidase-6 (M10.024) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by membrane-type matrix metallopeptidase-6 (M10.024) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by neutral protease Npr599 () cleavage..

Alpha-1-antitrypsin is proteolytically cut by inhA g.p. (M06.001) cleavage..

Alpha-1-antitrypsin is proteolytically cut by adamalysin (M12.141) cleavage. AAGA-MFLE.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-18 (M10.018) cleavage. RPFE-VKDT.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. RPFE-VKDT.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-11 (M10.007) cleavage. AAGA-MFLE.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by aureolysin (M04.009) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by pseudolysin (M04.005) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by peptidase 1 (C01.073) cleavage. PQGD-AAQK.

Alpha-1-antitrypsin is proteolytically cut by peptidase 1 (C01.073) cleavage. QKTD-TSHH.

Alpha-1-antitrypsin is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage..

Alpha-1-antitrypsin is proteolytically cut by (M04.022) cleavage. HDQD-HPTF.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. VSLA-EDPQ.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by mesotrypsin (S01.174) cleavage. AAQK-TDTS.

Alpha-1-antitrypsin is proteolytically cut by cysteine proteinase () cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by metalloproteinase () cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by Allergen Der P1 () cleavage. FLEA-IPMS.

Alpha-1-antitrypsin is proteolytically cut by glutamyl peptidase I (S01.269) cleavage. MFLE-AIPM.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by mesotrypsin (S01.174) cleavage. AAQK-TDTS.

Alpha-1-antitrypsin is proteolytically cut by () cleavage..

Alpha-1-antitrypsin is proteolytically cut by elastase-2 (S01.131) cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by periodontain (C10.003) cleavage. MFLE-AIPM.

Alpha-1-antitrypsin is proteolytically cut by periodontain (C10.003) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. PFVF-LMIE.

Alpha-1-antitrypsin is proteolytically cut by cathepsin L (C01.032) cleavage. MFLE-AIPM.

Alpha-1-antitrypsin is proteolytically cut by cathepsin L (C01.032) cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by mesotrypsin (S01.174) cleavage. AAQK-TDTS.

Alpha-1-antitrypsin is proteolytically cut by glutamyl peptidase I (S01.269) cleavage. MFLE-AIPM.

Alpha-1-antitrypsin is proteolytically cut by adamalysin (M12.141) cleavage. AAGA-MFLE.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by Allergen Der P1 () cleavage. MFLE-AIPM.

Alpha-1-antitrypsin is proteolytically cut by pseudolysin (M04.005) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by papain (C01.001) cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by serralysin (M10.051) cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by pollen endopeptidase () cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by oryzin (S08.053) cleavage. AIPM-SIPP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by membrane-type matrix metallopeptidase-6 (M10.024) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by membrane-type matrix metallopeptidase-6 (M10.024) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by neutral protease Npr599 () cleavage..

Alpha-1-antitrypsin is proteolytically cut by inhA g.p. (M06.001) cleavage..

Alpha-1-antitrypsin is proteolytically cut by adamalysin (M12.141) cleavage. AAGA-MFLE.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-18 (M10.018) cleavage. RPFE-VKDT.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. RPFE-VKDT.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-11 (M10.007) cleavage. AAGA-MFLE.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by aureolysin (M04.009) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by pseudolysin (M04.005) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by peptidase 1 (C01.073) cleavage. PQGD-AAQK.

Alpha-1-antitrypsin is proteolytically cut by peptidase 1 (C01.073) cleavage. QKTD-TSHH.

Alpha-1-antitrypsin is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage..

Alpha-1-antitrypsin is proteolytically cut by (M04.022) cleavage. HDQD-HPTF.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. VSLA-EDPQ.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. EAIP-MSIP.

Alpha-1-antitrypsin is proteolytically cut by mesotrypsin (S01.174) cleavage. AAQK-TDTS.

Alpha-1-antitrypsin is proteolytically cut by cysteine proteinase () cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by metalloproteinase () cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by Allergen Der P1 () cleavage. FLEA-IPMS.

Alpha-1-antitrypsin is proteolytically cut by glutamyl peptidase I (S01.269) cleavage. MFLE-AIPM.

Alpha-1-antitrypsin is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. GAMF-LEAI.

Alpha-1-antitrypsin is proteolytically cut by mesotrypsin (S01.174) cleavage. AAQK-TDTS.

Alpha-1-antitrypsin is proteolytically cut by () cleavage..

Alpha-1-antitrypsin is proteolytically cut by glutamyl peptidase I (S01.269) cleavage. MFLE-AIPM.

Alpha-1-antitrypsin is proteolytically cut by staphopain A (C47.001) cleavage. MFLE-AIPM.