Protein kinase C zeta type

UniProt : Q05513, UniProt ID: KPCZ_HUMAN,

Protein kinase C zeta type

Homo sapiens

MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKW
VDSEGDPCTVSSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGAR
RWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTC
RKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDG
IKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTE
KHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEI
CIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAP
EILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRF
LSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQIT
DDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Protein kinase C zeta type contains a PF00069 domain.

Protein kinase C zeta type contains a PF00130 domain.

Protein kinase C zeta type contains a PF00433 domain.

Protein kinase C zeta type contains a PF00564 domain.

Protein kinase C zeta type is proteolytically cut by caspase-3 (C14.003) cleavage. EETD-GIAY.

Protein kinase C zeta type is proteolytically cut by caspase-6 (C14.005) cleavage. EETD-GIAY.

Protein kinase C zeta type is proteolytically cut by caspase-7 (C14.004) cleavage. EETD-GIAY.

Protein kinase C zeta type is proteolytically cut by caspase-8 (C14.009) cleavage. EETD-GIAY.

Protein kinase C zeta type is proteolytically cut by caspase-3 (C14.003) cleavage. DGMD-GIKI.

Protein kinase C zeta type is proteolytically cut by caspase-7 (C14.004) cleavage. DSED-LKPV.