Ghrelin splice variant (Ghrelin, growth hormone secretagogue receptor ligand, isoform CRA_b)

UniProt : A8CF34, Q9UBU3, UniProt ID: A8CF34_HUMAN, GHRL_HUMAN,

Ghrelin splice variant (Ghrelin, growth hormone secretagogue receptor ligand, isoform CRA_b)

Homo sapiens

MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPE
DGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Ghrelin splice variant (Ghrelin, growth hormone secretagogue receptor ligand, isoform CRA_b) contains a PF04643 domain.

Ghrelin splice variant (Ghrelin, growth hormone secretagogue receptor ligand, isoform CRA_b) contains a PF04644 domain.

Ghrelin splice variant (Ghrelin, growth hormone secretagogue receptor ligand, isoform CRA_b) is proteolytically cut by angiotensin-converting enzyme 2 (M02.006) cleavage. KLQP-RALA.