Chordin

UniProt : A2CG34, Q9Z0E2, UniProt ID: A2CG34_MOUSE, CHRD_MOUSE,

Chordin

Mus musculus

MPSLPAPPAPRLLLGLLLLGSRPASGTGPEPPALPIRSEKEPLPVRGAAGCSFGGKVYAL
DETWHPDLGEPFGVMRCVLCACEAPQWARRGRGPGRVSCKNIKPQCPTLACRQPRQLPGH
CCQTCPQERSNLDPQPAGLVFEYPRDPEHRSYSDRGEPGVGERTRADGHTDFVALLTGPR
SQAVARARVSLLRSSLRFSVSYQRLDRPSRVRFTDPTGNILFEHPATPTQDGLVCGVWRA
VPRLSVRLLRAEQLRVALVTSTHPSGEVWGPLIWQGALAAETFSAILTLEDPLQRGVGGI
ALLTLSDTEDSLHFLLLFRGLLGGLAQAPLKLQILHQGQLLRELQANTSAQEPGFAEVLP
SLTDQEMDWLELGELQMVLEKAGGPELRISGYITTRQSCDVLQSVLCGADALIPVQTGAA
GSASFILLGNGSLIYQVQVVGTGSEVVAMTLETKPQRKNQRTVLCHMAGLQPGGHMAVGM
CSGLGARGAHMLLQNELFLNVGTKDFPDGELRGHVTALCYSGHSARYDRLPVPLAGALVL
PPVRSQAAGHAWLSLDTHCHLHYEVLLAGLGGSEQGTVTAHLLGPPGMPGPQRLLKGFYG
SEAQGVVKDLEPVLLRHLAQGTASLLITTKSSPRGELRGQVHIASQCEAGGLRLASEGVQ
MPLAPNGEAATSPMLPAGPGPEAPVPAKHGSPGRPRDPNTCFFEGQQRPHGARWAPNYDP
LCSLCICQRRTVICDPVVCPPPSCPHPVQALDQCCPVCPEKQRSRDLPSLPNLEPGEGCY
FDGDRSWRAAGTRWHPVVPPFGLIKCAVCTCKGATGEVHCEKVQCPRLACAQPVRANPTD
CCKQCPVGSGTNAKLGDPMQADGPRGCRFAGQWFPENQSWHPSVPPFGEMSCITCRCGAG
VPHCERDDCSPPLSCGSGKESRCCSHCTAQRSSETRTLPELEKEAEHS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Chordin contains a PF00093 domain.

Chordin contains a PF00093 domain.

Chordin contains a PF07452 domain.

Chordin contains a PF07452 domain.

Chordin contains a PF07452 domain.

Chordin contains a PF07452 domain.

Chordin contains a PF00093 domain.

Chordin contains a PF00093 domain.

Chordin is proteolytically cut by mammalian tolloid-like 1 protein (M12.016) cleavage. GEAA-TSPM.