Microtubule-associated proteins 1A/1B light chain 3A

UniProt : Q9H492, UniProt ID: MLP3A_HUMAN,

Microtubule-associated proteins 1A/1B light chain 3A

Homo sapiens

MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNM
SELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFG
F

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Microtubule-associated proteins 1A/1B light chain 3A contains a PF02991 domain.

Microtubule-associated proteins 1A/1B light chain 3A is proteolytically cut by ATG4 peptidase (C54.003) cleavage. ETFG-F---.