Putative uncharacterized protein ABCF2 (ATP-binding cassette, sub-family F (GCN20), member 2, isoform CRA_b) (ATP-binding cassette, sub-family F (GCN20), member 2)

UniProt : Q75MJ0, Q9UG63, UniProt ID: ABCF2_HUMAN, Q75MJ0_HUMAN,

Putative uncharacterized protein ABCF2 (ATP-binding cassette, sub-family F (GCN20), member 2, isoform CRA_b) (ATP-binding cassette, sub-family F (GCN20), member 2)

Homo sapiens

MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKEL
EDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLN
GIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLA
HEDAECEKLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALA
RALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILVLVSHSQDFLNGVCTNIIHMHN
KKLKYYTGNYDQYVKTRLELEENQMKRFHWEQDQIAHMKNYIARFGHGSAKLARQAQSKE
KTLQKMMASGLTERVVSDKTLSFYFPPCGKIPPPVIMVQNVSFKYTKDGPCIYNNLEFGI
DLDTRVALVGPNGAGKSTLLKLLTGELLPTDGMIRKHSHVKIGRYHQHLQEQLDLDLSPL
EYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFL
DEPTNHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILA
YKEHLKSKLVDEEPQLTKRTHNV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein ABCF2 (ATP-binding cassette, sub-family F (GCN20), member 2, isoform CRA_b) (ATP-binding cassette, sub-family F (GCN20), member 2) contains a PF00005 domain.

Putative uncharacterized protein ABCF2 (ATP-binding cassette, sub-family F (GCN20), member 2, isoform CRA_b) (ATP-binding cassette, sub-family F (GCN20), member 2) contains a PF00005 domain.

Putative uncharacterized protein ABCF2 (ATP-binding cassette, sub-family F (GCN20), member 2, isoform CRA_b) (ATP-binding cassette, sub-family F (GCN20), member 2) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. TEVD-LLTK.