ATP-binding cassette sub-family F member 2

UniProt : Q99LE6, UniProt ID: ABCF2_MOUSE,

ATP-binding cassette sub-family F member 2

Mus musculus

MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDAVTEPQVAEEKIEEANGRETTGDGEVDL
LTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYG
LIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSEKTPLQCVMEVDTERAMLERE
AERLAHEDAECEKLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRM
RVALARALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILVLVSHSQDFLNGVCTNI
IHMHNKKLKYYTGNYDQYVKTRLELEENQMKRFHWEQDQIAHMKNYIARFGHGSAKLARQ
AQSKEKTLQKMMASGLTERVVSDKTLSFYFPPCGKIPPPVIMVQNVSFKYTKDGPCIYNN
LEFGIDLDTRVALVGPNGAGKSTLLKLLTGELLPTDGMIRKHSHVKIGRYHQHLQEQLDL
DLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNP
HMLFLDEPTNHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWP
GDILAYKEHLKSKLVDEEPQLTKRTHNV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

ATP-binding cassette sub-family F member 2 contains a PF00005 domain.

ATP-binding cassette sub-family F member 2 contains a PF00005 domain.

ATP-binding cassette sub-family F member 2 is proteolytically cut by granzyme B, human-type (S01.010) cleavage. GEVD-LLTK.