Matrix metalloproteinase-24

UniProt : Q9R0S2, UniProt ID: MMP24_MOUSE,

Matrix metalloproteinase-24

Mus musculus

MPRSRGGRAAPGQASRWSGWRAPGRLLPLLPALCCLAAAAGAGKPTGADAPFAGQNWLKS
YGYLLPYESRASALHSGKALQSAVSTMQQFYGIPVTGVLDQTTIEWMKKPRCGVPDHPHL
SRRRRNKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAFDVWQKVTPLTFEEVP
YHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLG
NANHDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNFKLPQDDLQGIQKIYG
PPAEPLEPTRPLPTLPVRRIHSPSERKHERHPRPPRPPLGDRPSTPGAKPNICDGNFNTV
ALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQFWKGLPARIDAAYERADGRFVFFKGDK
YWVFKEVTVEPGYPHSLGELGSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATD
PGYPKPITVWKGIPQAPQGAFISKEGYYTYFYKGRDYWKFDNQKLSVEPGYPRNILRDWM
GCKQKEVERRKERRLPQDDVDIMVTIDDVPGSVNAVAVVVPCTLSLCLLVLLYTIFQFKN
KAGPQPVTYYKRPVQEWV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Matrix metalloproteinase-24 contains a PF00045 domain.

Matrix metalloproteinase-24 contains a PF00045 domain.

Matrix metalloproteinase-24 contains a PF00045 domain.

Matrix metalloproteinase-24 contains a PF00045 domain.

Matrix metalloproteinase-24 contains a PF00413 domain.

Matrix metalloproteinase-24 contains a PF01471 domain.

Matrix metalloproteinase-24 is proteolytically cut by furin (S08.071) cleavage..