Putative uncharacterized protein POMC (Proopiomelanocortin (Adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin), isoform CRA_a)

UniProt : P01189, Q53T23, UniProt ID: COLI_HUMAN, Q53T23_HUMAN,

Putative uncharacterized protein POMC (Proopiomelanocortin (Adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin), isoform CRA_a)

Homo sapiens

MPRSCCSRSGALLLALLLQASMEVRGWCLESSQCQDLTTESNLLECIRACKPDLSAETPM
FPGNGDEQPLTENPRKYVMGHFRWDRFGRRNSSSSGSSGAGQKREDVSAGEDCGPLPEGG
PEPRSDGAKPGPREGKRSYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEFKREL
TGQRLREGDGPDGPADDGAGAQADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKDKRYGGF
MTSEKSQTPLVTLFKNAIIKNAYKKGE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein POMC (Proopiomelanocortin (Adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin), isoform CRA_a) contains a PF08384 domain.

Putative uncharacterized protein POMC (Proopiomelanocortin (Adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin), isoform CRA_a) contains a PF08035 domain.

Putative uncharacterized protein POMC (Proopiomelanocortin (Adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin), isoform CRA_a) contains a PF00976 domain.

Putative uncharacterized protein POMC (Proopiomelanocortin (Adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin), isoform CRA_a) is proteolytically cut by meprin alpha subunit (M12.002) cleavage. RSYS-MEHF.

Putative uncharacterized protein POMC (Proopiomelanocortin (Adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin), isoform CRA_a) is proteolytically cut by meprin alpha subunit (M12.002) cleavage. FRWG-KPVG.

Putative uncharacterized protein POMC (Proopiomelanocortin (Adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin), isoform CRA_a) is proteolytically cut by meprin alpha subunit (M12.002) cleavage. RSYS-MEHF.

Putative uncharacterized protein POMC (Proopiomelanocortin (Adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin), isoform CRA_a) is proteolytically cut by meprin alpha subunit (M12.002) cleavage. FRWG-KPVG.

Putative uncharacterized protein POMC (Proopiomelanocortin (Adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin), isoform CRA_a) is proteolytically cut by acylaminoacyl-peptidase (S09.004) cleavage..

Putative uncharacterized protein POMC (Proopiomelanocortin (Adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin), isoform CRA_a) is proteolytically cut by penicillolysin (M35.001) cleavage. HFRW-GKPV.

Putative uncharacterized protein POMC (Proopiomelanocortin (Adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin), isoform CRA_a) is proteolytically cut by penicillolysin (M35.001) cleavage. MEHF-RWGK.

Putative uncharacterized protein POMC (Proopiomelanocortin (Adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin), isoform CRA_a) is proteolytically cut by penicillolysin (M35.001) cleavage. --SY-SMEH.

Putative uncharacterized protein POMC (Proopiomelanocortin (Adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin), isoform CRA_a) is proteolytically cut by gingipain K (C25.002) cleavage. TSEK-SQTP.

Putative uncharacterized protein POMC (Proopiomelanocortin (Adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin), isoform CRA_a) is proteolytically cut by gingipain K (C25.002) cleavage. NAYK-KGE-.

Putative uncharacterized protein POMC (Proopiomelanocortin (Adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin), isoform CRA_a) is proteolytically cut by gingipain K (C25.002) cleavage. AIIK-NAYK.

Putative uncharacterized protein POMC (Proopiomelanocortin (Adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin), isoform CRA_a) is proteolytically cut by gingipain K (C25.002) cleavage. TLFK-NAII.