Putative uncharacterized protein MATN3 (Matrilin 3)

UniProt : O15232, Q4ZG02, UniProt ID: MATN3_HUMAN, Q4ZG02_HUMAN,

Putative uncharacterized protein MATN3 (Matrilin 3)

Homo sapiens

MPRPAPARRLPGLLLLLWPLLLLPSAAPDPVARPGFRRLETRGPGGSPGRRPSPAAPDGA
PASGTSEPGRARGAGVCKSRPLDLVFIIDSSRSVRPLEFTKVKTFVSRIIDTLDIGPADT
RVAVVNYASTVKIEFQLQAYTDKQSLKQAVGRITPLSTGTMSGLAIQTAMDEAFTVEAGA
REPSSNIPKVAIIVTDGRPQDQVNEVAARAQASGIELYAVGVDRADMASLKMMASEPLEE
HVFYVETYGVIEKLSSRFQETFCALDPCVLGTHQCQHVCISDGEGKHHCECSQGYTLNAD
KKTCSALDRCALNTHGCEHICVNDRSGSYHCECYEGYTLNEDRKTCSAQDKCALGTHGCQ
HICVNDRTGSHHCECYEGYTLNADKKTCSVRDKCALGSHGCQHICVSDGAASYHCDCYPG
YTLNEDKKTCSATEEARRLVSTEDACGCEATLAFQDKVSSYLQRLNTKLDDILEKLKINE
YGQIHR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein MATN3 (Matrilin 3) contains a PF00008 domain.

Putative uncharacterized protein MATN3 (Matrilin 3) contains a PF00008 domain.

Putative uncharacterized protein MATN3 (Matrilin 3) contains a PF00008 domain.

Putative uncharacterized protein MATN3 (Matrilin 3) contains a PF00008 domain.

Putative uncharacterized protein MATN3 (Matrilin 3) contains a PF00092 domain.

Putative uncharacterized protein MATN3 (Matrilin 3) is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. RPLE-FTKV.

Putative uncharacterized protein MATN3 (Matrilin 3) is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. ATEE-ARRL.