ORF of MTV-7

UniProt : Q9W7W5, UniProt ID: Q9W7W5_9BETR,

ORF of MTV-7

Mouse mammary tumor virus

MPRLQQKWLNSRECPTLRREAAKGLFPTKDDPSACTRMSPSDKDILILCCKLGIALLCLG
LLGEVAVRARRALTLDSFNSSSVQDYNLNDSENSTFLLGQGPQPTSSYKPHRLCPSEIEI
RMLAKNYIFTNKTNPIGRLLITMLRNESLPFSTIFTQIQRLEMGIENRKRRSTAVKEQVQ
GLSATGLEVKEGKRSVFVKIGDRWWQPGTYRGPYIYRPTDAPLPYTGRFDLNFDRWVTVN
GYKVLYRSLPFRERLARARPPWCVLTQEEKDDMKQQVHDYIYLGTGMNFWGKIFDYTEEG
AIAKILYNMKYTHGGRVGFDPF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

ORF of MTV-7 contains a PF01054 domain.

ORF of MTV-7 is proteolytically cut by furin (S08.071) cleavage. RKRR-STAV.

ORF of MTV-7 is proteolytically cut by furin (S08.071) cleavage. RARR-ALTL.