Sjogren syndrome antigen B (Autoantigen La) (Sjogren syndrome antigen B (Autoantigen La), isoform CRA_c) (Putative uncharacterized protein SSB)

UniProt : P05455, Q53XJ4, UniProt ID: LA_HUMAN, Q53XJ4_HUMAN,

Sjogren syndrome antigen B (Autoantigen La) (Sjogren syndrome antigen B (Autoantigen La), isoform CRA_c) (Putative uncharacterized protein SSB)

Homo sapiens

MAENGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNR
LTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPT
DATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDL
LILFKDDYFAKKNEERKQNKVEAKLRAKQEQEAKQKLEEDAEMKSLEEKIGCLLKFSGDL
DDQTCREDLHILFSNHGEIKWIDFVRGAKEGIILFKEKAKEALGKAKDANNGNLQLRNKE
VTWEVLEGEVEKEALKKIIEDQQESLNKWKSKGRRFKGKGKGNKAAQPGSGKGKVQFQGK
KTKFASDDEHDEHDENGATGPVKRAREETDKEEPASKQQKTENGAGDQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Sjogren syndrome antigen B (Autoantigen La) (Sjogren syndrome antigen B (Autoantigen La), isoform CRA_c) (Putative uncharacterized protein SSB) contains a PF00076 domain.

Sjogren syndrome antigen B (Autoantigen La) (Sjogren syndrome antigen B (Autoantigen La), isoform CRA_c) (Putative uncharacterized protein SSB) contains a PF05383 domain.

Sjogren syndrome antigen B (Autoantigen La) (Sjogren syndrome antigen B (Autoantigen La), isoform CRA_c) (Putative uncharacterized protein SSB) contains a PF08777 domain.

Sjogren syndrome antigen B (Autoantigen La) (Sjogren syndrome antigen B (Autoantigen La), isoform CRA_c) (Putative uncharacterized protein SSB) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. LEED-AEMK.