Putative uncharacterized protein

UniProt : Q9CPR2, UniProt ID: Q9CPR2_MOUSE,

Putative uncharacterized protein

Mus musculus

MPRLCVYMLVLVLALATFSEASWKPRSQLQDASSGPGTNEDLEQRQFNKLGSASHHRRQL
GPQGPQHFIADLSKKQRPRMEEEEEAYGWMDFGRRSAEEDQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF00918 domain.

Putative uncharacterized protein is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. HHRR-QLGL.

Putative uncharacterized protein is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. FGRR-SAEE.

Putative uncharacterized protein is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. LSKK-ERPR.