Guanine nucleotide binding protein-like 1 (Guanine nucleotide binding protein-like 1, isoform CRA_a)

UniProt : B0S838, P36915, UniProt ID: B0S838_HUMAN, GNL1_HUMAN,

Guanine nucleotide binding protein-like 1 (Guanine nucleotide binding protein-like 1, isoform CRA_a)

Homo sapiens

MPRKKPFSVKQKKKQLQDKRERKRGLQDGLRSSSNSRSGSRERREEQTDTSDGESVTHHI
RRLNQQPSQGLGPRGYDPNRYRLHFERDSREEVERRKRAAREQVLQPVSAELLELDIREV
YQPGSVLDFPRRPPWSYEMSKEQLMSQEERSFQDYLGKIHGAYSSEKLSYFEHNLETWRQ
LWRVLEMSDIVLLITDIRHPVVNFPPALYEYVTGELGLALVLVLNKVDLAPPALVVAWKH
YFHQHYPQLHVVLFTSFPRDPRTPQDPSSVLKKSRRRGRGWTRALGPEQLLRACEAITVG
KVDLSSWREKIARDVAGATWGNGSGEEEEEEDGPAVLVEQQTDSAMEPTGPTQERYKDGV
VTIGCVGFPNVGKSSLINGLVGRKVVSVSRTPGHTRYFQTYFLTPSVKLCDCPGLIFPSL
LPRQLQVLAGIYPIAQIQEPYTAVGYLASRIPVQALLHLRHPEAEDPSAEHPWCAWDICE
AWAEKRGYKTAKAARNDVYRAANSLLRLAVDGRLSLCFHPPGYSEQKGTWESHPETTELV
VLQGRVGPAGDEEEEEEEELSSSCEEEGEEDRDADEEGEGDEETPTSAPGSSLAGRNPYA
LLGEDEC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Guanine nucleotide binding protein-like 1 (Guanine nucleotide binding protein-like 1, isoform CRA_a) contains a PF01926 domain.

Guanine nucleotide binding protein-like 1 (Guanine nucleotide binding protein-like 1, isoform CRA_a) is proteolytically cut by caspase () cleavage. QQTD-SAME.