Corticotropin-lipotropin

UniProt : P01193, UniProt ID: COLI_MOUSE,

Corticotropin-lipotropin

Mus musculus

MPRFCYSRSGALLLALLLQTSIDVWSWCLESSQCQDLTTESNLLACIRACKLDLSLETPV
FPGNGDEQPLTENPRKYVMGHFRWDRFGPRNSSSAGSAAQRRAEEEAVWGDGSPEPSPRE
GKRSYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEFKRELEGERPLGLEQVLES
DAEKDDGPYRVEHFRWSNPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Corticotropin-lipotropin contains a PF08035 domain.

Corticotropin-lipotropin contains a PF08384 domain.

Corticotropin-lipotropin contains a PF00976 domain.

Corticotropin-lipotropin is proteolytically cut by proprotein convertase 2 (S08.072) cleavage. EGKR-SYSM.

Corticotropin-lipotropin is proteolytically cut by proprotein convertase 2 (S08.072) cleavage. GKKR-RPVK.

Corticotropin-lipotropin is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. EFKR-ELEG.

Corticotropin-lipotropin is proteolytically cut by proprotein convertase 2 (S08.072) cleavage. KDKR-YGGF.

Corticotropin-lipotropin is proteolytically cut by proprotein convertase 2 (S08.072) cleavage. AHKK-GQ--.

Corticotropin-lipotropin is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. EGKR-SYSM.

Corticotropin-lipotropin is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. ENPR-KYVM.

Corticotropin-lipotropin is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. AHKK-GQ--.

Corticotropin-lipotropin is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. EGKR-SYSM.

Corticotropin-lipotropin is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. KDKR-YGGF.

Corticotropin-lipotropin is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. EFKR-ELEG.

Corticotropin-lipotropin is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. GKKR-RPVK.

Corticotropin-lipotropin is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. AQRR-AEEE.

Corticotropin-lipotropin is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. EGKR-SYSM.

Corticotropin-lipotropin is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. KDKR-YGGF.

Corticotropin-lipotropin is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. EFKR-ELEG.

Corticotropin-lipotropin is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. AQRR-AEEE.

Corticotropin-lipotropin is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. NPRK-YVMG.

Corticotropin-lipotropin is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. AQRR-AEEE.