TUBG1 protein (cDNA, FLJ93861, highly similar to Homo sapiens tubulin, gamma 1 (TUBG1), mRNA) (Fragment)

UniProt : P23258, Q53X79, UniProt ID: Q53X79_HUMAN, TBG1_HUMAN,

TUBG1 protein (cDNA, FLJ93861, highly similar to Homo sapiens tubulin, gamma 1 (TUBG1), mRNA) (Fragment)

Homo sapiens

MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHY
IPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFD
IIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSD
VVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSAST
TTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQP
KNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVAL
SRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDE
MDTSREIVQQLIDEYHAATRPDYISWGTQEQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

TUBG1 protein (cDNA, FLJ93861, highly similar to Homo sapiens tubulin, gamma 1 (TUBG1), mRNA) (Fragment) contains a PF00091 domain.

TUBG1 protein (cDNA, FLJ93861, highly similar to Homo sapiens tubulin, gamma 1 (TUBG1), mRNA) (Fragment) contains a PF03953 domain.

TUBG1 protein (cDNA, FLJ93861, highly similar to Homo sapiens tubulin, gamma 1 (TUBG1), mRNA) (Fragment) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. ISPE-GIVE.