Glutathione S-transferase P

UniProt : P04906, UniProt ID: GSTP1_RAT,

Glutathione S-transferase P

Rattus norvegicus

MPPYTIVYFPVRGRCEATRMLLADQGQSWKEEVVTIDVWLQGSLKSTCLYGQLPKFEDGD
LTLYQSNAILRHLGRSLGLYGKDQKEAALVDMVNDGVEDLRCKYGTLIYTNYENGKDDYV
KALPGHLKPFETLLSQNQGGKAFIVGNQISFADYNLLDLLLVHQVLAPGCLDNFPLLSAY
VARLSARPKIKAFLSSPDHLNRPINGNGKQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Glutathione S-transferase P contains a PF00043 domain.

Glutathione S-transferase P contains a PF02798 domain.

Glutathione S-transferase P is proteolytically cut by calpain-2 (C02.002) cleavage..