cDNA FLJ75028, highly similar to Homo sapiens retinoblastoma 1 (including osteosarcoma) (RB1), mRNA (Retinoblastoma 1 (Including osteosarcoma), isoform CRA_a)

UniProt : A8K5E3, P06400, UniProt ID: A8K5E3_HUMAN, RB_HUMAN,

cDNA FLJ75028, highly similar to Homo sapiens retinoblastoma 1 (including osteosarcoma) (RB1), mRNA (Retinoblastoma 1 (Including osteosarcoma), isoform CRA_a)

Homo sapiens

MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTAL
CQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTEL
QKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSS
ISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYK
TAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFM
NSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKS
NLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVK
DIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDN
IFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEG
NLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNH
TAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYL
RLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLK
FKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLS
PIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFG
TSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQK
LAEMTSTRTRMQKQKMNDSMDTSNKEEK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ75028, highly similar to Homo sapiens retinoblastoma 1 (including osteosarcoma) (RB1), mRNA (Retinoblastoma 1 (Including osteosarcoma), isoform CRA_a) contains a PF01857 domain.

cDNA FLJ75028, highly similar to Homo sapiens retinoblastoma 1 (including osteosarcoma) (RB1), mRNA (Retinoblastoma 1 (Including osteosarcoma), isoform CRA_a) contains a PF08934 domain.

cDNA FLJ75028, highly similar to Homo sapiens retinoblastoma 1 (including osteosarcoma) (RB1), mRNA (Retinoblastoma 1 (Including osteosarcoma), isoform CRA_a) contains a PF01858 domain.

cDNA FLJ75028, highly similar to Homo sapiens retinoblastoma 1 (including osteosarcoma) (RB1), mRNA (Retinoblastoma 1 (Including osteosarcoma), isoform CRA_a) is proteolytically cut by caspase () cleavage. LQTD-SIDS.

cDNA FLJ75028, highly similar to Homo sapiens retinoblastoma 1 (including osteosarcoma) (RB1), mRNA (Retinoblastoma 1 (Including osteosarcoma), isoform CRA_a) is proteolytically cut by caspase () cleavage. LQTD-SIDS.

cDNA FLJ75028, highly similar to Homo sapiens retinoblastoma 1 (including osteosarcoma) (RB1), mRNA (Retinoblastoma 1 (Including osteosarcoma), isoform CRA_a) is proteolytically cut by caspase-3 (C14.003) cleavage. DSID-SFET.

cDNA FLJ75028, highly similar to Homo sapiens retinoblastoma 1 (including osteosarcoma) (RB1), mRNA (Retinoblastoma 1 (Including osteosarcoma), isoform CRA_a) is proteolytically cut by caspase-9 (C14.010) cleavage. LEND-TRII.

cDNA FLJ75028, highly similar to Homo sapiens retinoblastoma 1 (including osteosarcoma) (RB1), mRNA (Retinoblastoma 1 (Including osteosarcoma), isoform CRA_a) is proteolytically cut by caspase () cleavage. LQTD-SIDS.

cDNA FLJ75028, highly similar to Homo sapiens retinoblastoma 1 (including osteosarcoma) (RB1), mRNA (Retinoblastoma 1 (Including osteosarcoma), isoform CRA_a) is proteolytically cut by caspase-3 (C14.003) cleavage. DSID-SFET.

cDNA FLJ75028, highly similar to Homo sapiens retinoblastoma 1 (including osteosarcoma) (RB1), mRNA (Retinoblastoma 1 (Including osteosarcoma), isoform CRA_a) is proteolytically cut by caspase-9 (C14.010) cleavage. LEND-TRII.

cDNA FLJ75028, highly similar to Homo sapiens retinoblastoma 1 (including osteosarcoma) (RB1), mRNA (Retinoblastoma 1 (Including osteosarcoma), isoform CRA_a) is proteolytically cut by calpain-1 (C02.001) cleavage. SPLK-SPYK.