Putative uncharacterized protein

UniProt : Q3U2W2, Q7TPV4, UniProt ID: MBB1A_MOUSE, Q3U2W2_MOUSE,

Putative uncharacterized protein

Mus musculus

MAEMKSPTKAEPATPAEAAQSDRHSLLEHSREFLDFFWDIAKPDQETRLRATEKLLEYLR
TRPNDSEMKYALKRLITGLGVGREAARPCYSLALAQLLQSFEDIPLCDILDQIQEKYSLQ
AMNKAMMRPSLFANLFGVLALFQSGRLVKDKEALMKSVQLLKILSQHPNHLQGQPIKALV
DILSEVPESMFQEILPKVLKGNMKVILRSPKYLELFLLAKQRVPTKLESLMGSVDLFSED
NIPSLVNILKVAANSVKKEHKLPNVALDLLRLALKESRFELFWKKVLEEGLLKNPSWTSS
YMCFRLLGASLPLLSEEQLQLVMRGDLIRHFGENMVISKPQNLFKIIPEISTYVGTFLEG
CQDDPKRQLTMMVAFTTITNQGLPVMPTFWRVTRFLNAEALQSYVAWLRDMFLQPDLNSL
VDFSTANQKRAQDASLNVPERAVFRLRKWIIHRLVSLVDHLHLEKDEAVVEQIARFCLFH
AFFKTKKATPQIPETKQHFSFPLDDRNRGVFVSAFFSLLQTLSVKFRQTPDLAENGKPWT
YRLVQLADMLLNHNRNVTSVTSLTTQQRQAWDQMMSTLKELEARSSETRAIAFQHLLLLV
GLHIFKSPAESCDVLGDIQTCIKKSMEQNPRRSRSRAKASQEPVWVEVMVEILLSLLAQP
SNLMRQVVRSVFGHICPHLTPRCLQLILAVLSPVTNEDEDDNVVVTDDADEKQLQHGEDE
DSDNEDNKNSESDMDSEDGEESEEEDRDKDVDPGFRQQLMEVLKAGNALGGVDNEEEEEL
GDEAMMALDQNLASLFKEQKMRIQARNEEKNKLQKEKKLRRDFQIRALDLIEVLVTKQPE
HPLILELLEPLLNVIQHSMRSKGSTKQEQDLLHKTARIFMHHLCRARRYCHEVGPCAEAL
HAQVERLVQQAGSQADASVALYYFNASLYLLRVLKGNTNKRHQDGHKLHGADTEDSEDQA
ANCLDLDFVTRVYSASLESLLTKRNSSLTVPMFLSLFSRYPVICKNLLPVLAQHVAGPSR
PRHQAQACLMLQKTLSARELRVCFEDPEWEQLITQLLGKATQTLQTLGEAQSKGEHQKEL
SILELLNTLLRTVNHEKLSVDLTAPLGVLQSKQQKLQQSLQQGNHSSGSNRLYDLYWQAM
RMLGVQRPKSEKKNAKDIPSDTQSPVSTKRKKKGFLPETKKRKKLKSEGTTPEKNAASQQ
DAVTEGAMPAATGKDQPPSTGKKKRKRVKASTPSQVNGITGAKSPAPSNPTLSPSTPAKT
PKLQKKKEKLSQVNGATPVSPIEPESKKHHQEALSTKEVIRKSPHPQSALPKKRARLSLV
SRSPSLLQSGVKKRRVASRRVQTP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF04931 domain.

Putative uncharacterized protein is proteolytically cut by granzyme B, human-type (S01.010) cleavage. SQQD-AVTE.