Wiskott-Aldrich syndrome protein family member 2

UniProt : Q9Y6W5, UniProt ID: WASF2_HUMAN,

Wiskott-Aldrich syndrome protein family member 2

Homo sapiens

MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSKYAEDIFGELFTQANT
FASRVSSLAERVDRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPV
LETYNTCDTPPPLNNLTPYRDDGKEALKFYTDPSYFFDLWKEKMLQDTKDIMKEKRKHRK
EKKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKEKLGTSGYPPTLVYQNGSIGCVEN
VDASSYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHP
PPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPD
FAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTGADGQPAIPPPL
SDTTKPKSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGNDVATILSRRIAVE
YSDSEDDSSEFDEDDWSD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Wiskott-Aldrich syndrome protein family member 2 contains a PF02205 domain.

Wiskott-Aldrich syndrome protein family member 2 is proteolytically cut by calpain-2 (C02.002) cleavage..

Wiskott-Aldrich syndrome protein family member 2 is proteolytically cut by calpain-2 (C02.002) cleavage..

Wiskott-Aldrich syndrome protein family member 2 is proteolytically cut by caspase () cleavage. TGAD-GQPA.