WAS protein family, member 3 (WAS protein family, member 3, isoform CRA_b) (cDNA FLJ76648, highly similar to Homo sapiens WAS protein family, member 3 (WASF3), mRNA)

UniProt : Q5T8P4, Q9UPY6, UniProt ID: Q5T8P4_HUMAN, WASF3_HUMAN,

WAS protein family, member 3 (WAS protein family, member 3, isoform CRA_b) (cDNA FLJ76648, highly similar to Homo sapiens WAS protein family, member 3 (WASF3), mRNA)

Homo sapiens

MPLVKRNIEPRHLCRGALPEGITSELECVTNSTLAAIIRQLSSLSKHAEDIFGELFNEAN
NFYIRANSLQDRIDRLAVKVTQLDSTVEEVSLQDINMKKAFKSSTVQDQQVVSKNSIPNP
VADIYNQSDKPPPLNILTPYRDDKKDGLKFYTDPSYFFDLWKEKMLQDTEDKRKEKRRQK
EQKRIDGTTREVKKVRKARNRRQEWNMMAYDKELRPDNRLSQSVYHGASSEGSLSPDTRS
HASDVTDYSYPATPNHSLHPQPVTPSYAAGDVPPHGPASQAAEHEYRPPSASARHMALNR
PQQPPPPPPPQAPEGSQASAPMAPADYGMLPAQIIEYYNPSGPPPPPPPPVIPSAQTAFV
SPLQMPMQPPFPASASSTHAAPPHPPSTGLLVTAPPPPGPPPPPPGPPGPGSSLSSSPMH
GPPVAEAKRQEPAQPPISDARSDLLAAIRMGIQLKKVQEQREQEAKREPVGNDVATILSR
RIAVEYSDSDDDSEFDENDWSD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

WAS protein family, member 3 (WAS protein family, member 3, isoform CRA_b) (cDNA FLJ76648, highly similar to Homo sapiens WAS protein family, member 3 (WASF3), mRNA) contains a PF02205 domain.

WAS protein family, member 3 (WAS protein family, member 3, isoform CRA_b) (cDNA FLJ76648, highly similar to Homo sapiens WAS protein family, member 3 (WASF3), mRNA) is proteolytically cut by calpain-2 (C02.002) cleavage..