Hydroxyacid oxidase 2

UniProt : Q07523, UniProt ID: HAOX2_RAT,

Hydroxyacid oxidase 2

Rattus norvegicus

MPLVCLADFKAHAQKQLSKTSWDFIEGEADDGITYSENIAAFKRIRLRPRYLRDMSKVDT
RTTIQGQEISAPICISPTAFHSIAWPDGEKSTARAAQEANICYVISSYASYSLEDIVAAA
PEGFRWFQLYMKSDWDFNKQMVQRAEALGFKALVITIDTPVLGNRRRDKRNQLNLEANIL
LKDLRALKEEKPTQSVPVSFPKASFCWNDLSLLQSITRLPIILKGILTKEDAELAMKHNV
QGIVVSNHGGRQLDEVSASIDALREVVAAVKGKIEVYMDGGVRTGTDVLKALALGARCIF
LGRPILWGLACKGEDGVKEVLDILTAELHRCMTLSGCQSVAEISPDLIQFSRL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Hydroxyacid oxidase 2 contains a PF01070 domain.

Hydroxyacid oxidase 2 is proteolytically cut by trypsin () cleavage. KDLR-ALKE.