cDNA FLJ78434, highly similar to Homo sapiens selectin P ligand (SELPLG), mRNA

UniProt : A8K2Y0, UniProt ID: A8K2Y0_HUMAN,

cDNA FLJ78434, highly similar to Homo sapiens selectin P ligand (SELPLG), mRNA

Homo sapiens

MPLQLLLLLILLGPGNSLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPP
EMLRNSTDTTPLTGPGTPESTTVEPAARRSTGLDAGGAVTELTTELANMGNLSTDSAAME
IQTTQPAATEAQTTPLAATEAQTTRLTATEAQTTPLAATEAQTTPPAATEAQTTQPTGLE
AQTTAPAAMEAQTTAPAAMEAQTTPPAAMEAQTTQTTAMEAQTTAPEATEAQTTQPTATE
AQTTPLAAMEALSTEPSATEALSMEPTTKRGLFIPFSVSSVTHKGIPMAASNLSVNYPVG
APDHISVKQCLLAILILALVATIFFVCTVVLAVRLSRKGHMYPVRNYSPTEMVCISSLLP
DGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSFLP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ78434, highly similar to Homo sapiens selectin P ligand (SELPLG), mRNA is proteolytically cut by mocarhagin (M12.173) cleavage. YLDY-DFLP.

cDNA FLJ78434, highly similar to Homo sapiens selectin P ligand (SELPLG), mRNA is proteolytically cut by (M12.167) cleavage. YLDY-DFLP.

cDNA FLJ78434, highly similar to Homo sapiens selectin P ligand (SELPLG), mRNA is proteolytically cut by memapsin-2 (A01.004) cleavage. ASNL-SVNY.

cDNA FLJ78434, highly similar to Homo sapiens selectin P ligand (SELPLG), mRNA is proteolytically cut by cathepsin G (S01.133) cleavage. EYEY-LDYD.

cDNA FLJ78434, highly similar to Homo sapiens selectin P ligand (SELPLG), mRNA is proteolytically cut by neutrophil elastase (S01.131) cleavage..