Platelet glycoprotein Ib alpha polypeptide (Fragment)

UniProt : A5CKE2, UniProt ID: A5CKE2_HUMAN,

Platelet glycoprotein Ib alpha polypeptide (Fragment)

Homo sapiens

MPLLLLLLLLPSPLHPHPICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLY
TFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTV
LDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELP
AGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNA
ENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGCPTLGDEGDTDLYDYYPEEDT
EGDKVRATRTVVKFPTKAHTTPWGLFYSWSTASLDSQMPSSLHPTQESTKEQTTFPPRWT
PNFTLHMESITFSKTPKSTTEPTPSPTTSEPVPEPAPNMTTLEPTPSPTTPEPTSEPAPS
PTTPEPTSEPAPSPTTPEPTPIPTIATSPTILVSATSLITPKSTFLTTTKPVSLLESTKK
TIPELDQPPKLRGVLQGHLESSRNDPFLHPDFCCLLPLGFYVLGLFWLLFASVVLILLLS
WVGHVKPQALDSGQGAALTTATQTTHLELQRGRQVTVPRAWLLFLRGSLPTFRSSLFLWV
RPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYSGHSL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Platelet glycoprotein Ib alpha polypeptide (Fragment) contains a PF00560 domain.

Platelet glycoprotein Ib alpha polypeptide (Fragment) contains a PF00560 domain.

Platelet glycoprotein Ib alpha polypeptide (Fragment) contains a PF01462 domain.

Platelet glycoprotein Ib alpha polypeptide (Fragment) contains a PF00560 domain.

Platelet glycoprotein Ib alpha polypeptide (Fragment) contains a PF00560 domain.

Platelet glycoprotein Ib alpha polypeptide (Fragment) is proteolytically cut by ADAM17 peptidase (M12.217) cleavage..