Platelet glycoprotein Ib alpha chain

UniProt : P07359, UniProt ID: GP1BA_HUMAN,

Platelet glycoprotein Ib alpha chain

Homo sapiens

MPLLLLLLLLPSPLHPHPICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLY
TFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTV
LDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELP
AGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNA
ENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGCPTLGDEGDTDLYDYYPEEDT
EGDKVRATRTVVKFPTKAHTTPWGLFYSWSTASLDSQMPSSLHPTQESTKEQTTFPPRWT
PNFTLHMESITFSKTPKSTTEPTPSPTTSEPVPEPAPNMTTLEPTPSPTTPEPTSEPAPS
PTTPEPTPIPTIATSPTILVSATSLITPKSTFLTTTKPVSLLESTKKTIPELDQPPKLRG
VLQGHLESSRNDPFLHPDFCCLLPLGFYVLGLFWLLFASVVLILLLSWVGHVKPQALDSG
QGAALTTATQTTHLELQRGRQVTVPRAWLLFLRGSLPTFRSSLFLWVRPNGRVGPLVAGR
RPSALSQGRGQDLLSTVSIRYSGHSL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Platelet glycoprotein Ib alpha chain contains a PF00560 domain.

Platelet glycoprotein Ib alpha chain contains a PF00560 domain.

Platelet glycoprotein Ib alpha chain contains a PF01462 domain.

Platelet glycoprotein Ib alpha chain contains a PF00560 domain.

Platelet glycoprotein Ib alpha chain contains a PF00560 domain.

Platelet glycoprotein Ib alpha chain is proteolytically cut by mocarhagin (M12.173) cleavage. YPEE-DTEG.

Platelet glycoprotein Ib alpha chain is proteolytically cut by (M12.167) cleavage. YPEE-DTEG.

Platelet glycoprotein Ib alpha chain is proteolytically cut by neutrophil elastase (S01.131) cleavage..

Platelet glycoprotein Ib alpha chain is proteolytically cut by cathepsin G (S01.133) cleavage. DTDL-YDYY.

Platelet glycoprotein Ib alpha chain is proteolytically cut by cathepsin G (S01.133) cleavage. TDLY-DYYP.

Platelet glycoprotein Ib alpha chain is proteolytically cut by mocarhagin (M12.173) cleavage. YPEE-DTEG.

Platelet glycoprotein Ib alpha chain is proteolytically cut by (M12.167) cleavage. YPEE-DTEG.

Platelet glycoprotein Ib alpha chain is proteolytically cut by neutrophil elastase (S01.131) cleavage..

Platelet glycoprotein Ib alpha chain is proteolytically cut by cathepsin G (S01.133) cleavage. DTDL-YDYY.

Platelet glycoprotein Ib alpha chain is proteolytically cut by cathepsin G (S01.133) cleavage. TDLY-DYYP.

Platelet glycoprotein Ib alpha chain is proteolytically cut by cathepsin G (S01.133) cleavage. DTDL-YDYY.