GH21964p (CG11546-PC, isoform C) (CG11546-PD, isoform D) (CG11546-PA, isoform A) (LP09416p)
|
UniProt : Q7JX82, UniProt ID: Q7JX82_DROME, GH21964p (CG11546-PC, isoform C) (CG11546-PD, isoform D) (CG11546-PA, isoform A) (LP09416p) Drosophila melanogaster MPLFTRKSPKQGPTSDGGSQFGSRSSMNSGSSQGSHISNNNNNSIPEKTKPPLVFHCQLA HGSPTGLIHDFSSVRELYQKIAECFDISEKDILFCTLNSHKVDMTRLLGGQIGLDDFIFA HRKGRPKEIEIVKSQDALGLTITDNGAGYAFIKRIKEDSIIDRIEHISVGDHIEKLNGQN MVGKRHYEVARMLKDIATGETFTLRLVEPVRSGFQGIGPRSQSRASGSAGGKNYGSGKET LRFKANGNAQIEPQFDEATVAGIEAINNLLESFMGINDTELASQIWDLGDQKSNSMDFAE AIDNSDLESFGFTDDFIIELWGAITDARRKSTTSPK The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
GH21964p (CG11546-PC, isoform C) (CG11546-PD, isoform D) (CG11546-PA, isoform A) (LP09416p) contains a PF00595 domain.
GH21964p (CG11546-PC, isoform C) (CG11546-PD, isoform D) (CG11546-PA, isoform A) (LP09416p) is proteolytically cut by furin (S08.071) cleavage. RDVR-GFAS.
GH21964p (CG11546-PC, isoform C) (CG11546-PD, isoform D) (CG11546-PA, isoform A) (LP09416p) is proteolytically cut by (M9G.026) cleavage. GFAS-FL--.