Proprotein convertase subtilisin/kexin type 7

UniProt : Q62849, UniProt ID: PCSK7_RAT,

Proprotein convertase subtilisin/kexin type 7

Rattus norvegicus

MPKGRQKVPRLDARLGLPICLCLELAIFFLVPQVMGLTEAGGLDTLGAGGLSWAVHLDSL
EGERKEESLIQQANAVAQAAGLVNAGRIGELQGHYLFVQPAGHGQAMEAEAMRQQAEAVL
AKHEAVRWHSEQRLLKRAKRSIHFNDPKYPQQWHLNNRRSPGRDINVTGVWERNVTGRGV
TVVVVDDGVEHTVQDIAPNYSPEGSYDLNSNDPDPMPHPDEENGNHHGTRCAGEIAAVPN
NSFCAVGVAYGSRIAGIRVLDGPLTDSMEAVAFNKHYQINDIYSCSWGPDDDGKTVDGPH
QLGKAALQHGVMAGRQGFGSIFVVASGNGGQHNDNCNYDGYANSIYTVTIGAVDEEGRMP
FYAEECASMLAVTFSGGDKMLRSIVTTDWDLQKGTGCTEGHTGTSAAAPLAAGMIALMLQ
VRPCLTWRDVQHIIVFTATQYEDHRADWLTNEAGFSHSHQHGFGLLNAWRLVNAAKIWTS
VPYLASYVSPMLKENKAVPRSPHSLEVLWNVSRTDLEMSGLKTLEHVAVTVSITHPRRGS
LELKLFCPSGMMSLIGAPRSMDSDPNGFNDWTFSTVRCWGERARGVYRLVIRDVGDEPLQ
VGILQQWQLTLYGSTWSPVDIKDRQSLLESAMSGKYLHDDFTLPCPPGLKIPEEDGYSIT
PNTLKTLVLVGCFSVFWTIYYMLEVCLSQRSKASTHGCRRGCCPWPPQSQNSKEVGTALE
SMPLCSSKDLDGVDSEHGDCTTASSLLAPELLGEADWSLSQNSKSDLDCPPHQPPDLKDG
QIC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Proprotein convertase subtilisin/kexin type 7 contains a PF00082 domain.

Proprotein convertase subtilisin/kexin type 7 contains a PF01483 domain.

Proprotein convertase subtilisin/kexin type 7 is proteolytically cut by () cleavage. RAKR-SIHF.