28 kDa heat- and acid-stable phosphoprotein

UniProt : Q13442, UniProt ID: HAP28_HUMAN,

28 kDa heat- and acid-stable phosphoprotein

Homo sapiens

MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDS
DESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKA
KERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLN
K

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

28 kDa heat- and acid-stable phosphoprotein is proteolytically cut by granzyme B, human-type (S01.010) cleavage. LDSD-ESED.